KEGG   Rhodobacter sphaeroides KD131: RSKD131_1361Help
Entry
RSKD131_1361      CDS       T00844                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rsk02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rsk02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1393665..1394765)
Genome map
AA seq 366 aa AA seqDB search
MKAAADRLMAARTREGRTRVLIVDDSAMVRQALALGLSTDPRLEVVGTASGAEAARAQMA
ALKPDVVTLDLEMPQMDGLTFLRSYMESAPVPTVVISSLTRTSGETAMRAMEAGAVDIIS
KPSLGAGQGLPAIMRDVCARVWAAARARLALPDGVAPAPVAPGASEDWIHALGASTGGVQ
ALSRILPFFPAQSPGLLVVQHMPEGFTAAFARRLDALCRMRVREAADGDLVLPGLVLIAP
GGLRHMDIERVGGVCRVRLVAGAPVSYSRPSVDRMFLSLAAAAGPRVSAALLTGMGRDGA
AGLLAIRRAGGRTFAQDEGSSAVFGMPLAARELRAAEEILTLDDIPARMMLAAAADTRAP
SLASND
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgccgccgaccggctgatggccgcgaggacccgcgaggggcgcacgcgcgtg
ctgatcgtggacgattccgccatggtccggcaggcgctggcgctggggctttcgaccgac
ccgcggctcgaggtggtgggcaccgcctcgggcgccgaggccgcgcgcgcacagatggcc
gcgctgaagcccgacgtggtgacgctcgatctcgagatgccgcagatggacgggctcacc
ttcctgcgcagctacatggagagcgcgccggtgcccacggtcgtcatctcctcgctcacg
cggacgagcggcgagacggccatgcgggccatggaggcgggagcggtcgacatcatctcg
aagccctcgctcggcgcgggccagggactgcccgcgatcatgcgcgatgtctgtgcccgg
gtctgggctgcggcccgggcccggctcgcgcttcccgatggcgtggcgcccgcccccgtc
gcgcccggcgcctcggaggactggatccacgcgctcggcgcctccaccggcggggtgcag
gccctgagccgcatcctgcccttcttcccggcccagtcgcccggcctcctcgtcgtccag
cacatgcccgagggcttcaccgcggccttcgcgcgccgcctcgatgcgctctgccggatg
cgggtgcgcgaagcggccgacggcgatctcgtgctgccgggcctcgtgctgatcgcgccc
ggcgggctgcgccacatggatatcgagcgggtgggcggggtctgccgggtgcggctcgtg
gcgggggcaccggtctcctactcgcgcccctcggttgaccggatgttcctgtcgctggcc
gcggccgccggtccgcgcgtctcggccgcgctcctgaccggcatggggcgcgacggcgcg
gccggtcttctcgcgatccgccgcgccggcgggcgcaccttcgcgcaggacgagggctcg
tcggccgtcttcggcatgccgcttgcagcacgcgagctgcgggcggccgaagagatcctg
acgctcgacgatatcccggcccgcatgatgctggccgcggcggcggacacgcgggcgccc
agcctcgcgtcaaacgactga

DBGET integrated database retrieval system