KEGG   Rhodobacter sphaeroides KD131: RSKD131_1600Help
Entry
RSKD131_1600      CDS       T00844                                 

Gene name
bchD
Definition
magnesium chelatase subunit D
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RSKD131_1600 (bchD)
Enzymes [BR:rsk01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RSKD131_1600 (bchD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1630649..1632325
Genome map
AA seq 558 aa AA seqDB search
MPLGPWERVEAALTLLAIDPAGLKGLWLRARASALRDRITGALGALPLPVRRIHPTIGDD
ALFGGLDLAATLSAGTPVVQKGILDEPAALVLAMAERTLPGLAARLGTALDAPRHCLIAL
DEGAERDELLPLGLVDRLALFLDVDGLPWGETREIALDPERLAAARARLAAVATPPEAAA
TLARVAAQLGIASLRAPTLALAAARAQAAWEGHAAVTDEDIRRAADLVFAHRAMPASEEA
PPEPEPEPPEDQPDDSPPPPEQQQGEEMFPEEMLVEAVRAALPDDLLEQLAAGRAARMAR
GATGTGSAKAGNRRGRPLPSRMGRLGTGARIDLVGTLRAAAPWQPLRRRQQKTDAVLLVR
PSDIRIKRFRETSDRVLIFAVDASGSSAMARLSEAKGAVELLLGQAYARRDHVSLLAFRG
RDAELILPPTRSLVQTKRRLAGLPGGGGTPLAHGLRLALAVGLQARARGMTPTVALLTDG
RGNIALDGSANRAQAEEDALKLAASLRGSGLPAVVIDTANRPQPSLAALARALDAPYIAL
PRADAHKLSNVLGAAMGD
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctcggcccgtgggaacgggtcgaggcggccctcacccttctcgccatcgaccct
gcgggcctcaagggcctctggctccgggcgcgggccagcgcgctgcgcgaccggatcacc
ggggcgctcggcgcgctgccgctgccggtccgccgcatccatccgaccatcggcgacgat
gcgctcttcggcgggctcgatctggccgcgaccctctcggccggcacgcccgtggtgcag
aagggcatcctcgacgagcccgcggcgctggttctcgccatggccgagcgcaccctgccc
ggtctcgcggcccggctcggcaccgcgctcgatgcgccgcgccactgcctgatcgcgctc
gacgagggcgccgagcgcgacgagctgctgccgctcggcctcgtggaccggctggcgctg
ttcctcgacgtcgacggcctgccctggggcgagacccgcgagatcgcgctcgaccccgag
cgcctcgccgcagcccgcgcccggctggccgcggtggcgaccccgcccgaggcggccgcg
accctcgcccgcgtggcggcgcagctcggcatcgcgagcctccgcgcgccgacgctggcg
ctggccgcggcccgcgcgcaggccgcctgggaaggtcacgccgccgtcacggacgaggac
atccgccgcgcggccgatctcgtcttcgcccatcgcgccatgcctgcctccgaggaggcc
ccgccggagcccgagcccgagccgcccgaggatcagcccgacgacagcccgccgccgccc
gagcagcagcagggcgaggagatgtttcccgaagagatgctggtcgaggccgtgcgggcg
gccctgccggacgatctcctcgagcagctggccgccggccgcgctgcgcggatggcgcgg
ggcgccaccggcaccggctcggccaaggccggcaaccgccgcggccgccccctgccctcg
cgcatgggccgcctcggcaccggcgcgcggatcgacctcgtgggcacgctgcgcgcggcc
gccccctggcagccgctccgccgccgccagcagaagaccgatgccgtcctgctcgtgcgg
ccctccgacatccgcatcaagcggttccgcgagacctcggaccgcgtgctgatcttcgcc
gtggatgcctcgggctcttcggccatggcgcggctctccgaggcgaagggcgcagtcgag
cttcttctggggcaggcctatgcccggcgcgaccatgtctcgctcctggccttccgcggc
cgcgacgccgagctgatcctgccgcccacccgcagcctcgtgcagacgaagcggcgcctc
gcgggcctgcccggcgggggcggcacgccgctcgcccacgggctgcggctggcgctggcc
gtggggcttcaggcccgcgcgcgcggcatgacgcccacggtcgcgcttctgaccgacggg
cgcggcaacatcgcgctcgacggctcggccaaccgggcgcaggccgaggaggatgcgctg
aagctcgcggcctcgctgcgcggctcgggtctgcccgcggtcgtgatcgacacggcgaac
cgcccgcagccctcgctcgcggccctcgcccgcgccctcgacgcgccctacatcgccctg
ccgcgggccgatgcccacaagctctcgaacgtcctcggcgcagcaatgggagactga

DBGET integrated database retrieval system