KEGG   Rhodobacter sphaeroides KD131: RSKD131_1623Help
Entry
RSKD131_1623      CDS       T00844                                 

Definition
cytochrome c2 cycA
Orthology
K08738  
cytochrome c
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RSKD131_1623
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RSKD131_1623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1657569..1658006
Genome map
AA seq 145 aa AA seqDB search
MKFQVKALAAIAAFAALPALAQEGDPEAGAKAFNQCQTCHVIVDDSGTTIAGRNAKTGPN
LYGVVGRTAGTQADFKGYGEGMKEAGAKGLAWDEEHFVQYVQDPTKFLKEYTGDAKAKGK
MTFKLKKEEDAHNIWAYLQQVAVRP
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgaagttccaagtcaaggccctcgccgccatcgccgccttcgcggcgctgccggcgctc
gcgcaggaaggcgacccggaagccggggccaaggccttcaaccagtgccagacctgccac
gtcatcgtggacgattccggcaccaccatcgccggccgcaacgccaagaccggcccgaac
ctctacggcgtcgtgggccgcaccgcgggcacgcaggccgacttcaagggctatggcgaa
ggcatgaaggaagccggcgcgaaagggctcgcctgggatgaagagcatttcgtccagtat
gttcaggatccgaccaagttcctgaaggaatataccggcgacgcgaaagccaagggcaag
atgaccttcaagctgaagaaggaagaggacgcccacaacatctgggcctacctccagcag
gtcgccgtccggccctga

DBGET integrated database retrieval system