KEGG   Rhodobacter sphaeroides KD131: RSKD131_1660Help
Entry
RSKD131_1660      CDS       T00844                                 

Definition
(GenBank) Cellulase precursor
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
rsk  Rhodobacter sphaeroides KD131
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(1690691..1691761)
Genome map
AA seq 356 aa AA seqDB search
MRRRTILTSAAAALMLAPAGRLLAQSGGEALPADHPLQAAWRSWKDAFLLPAGRIVDGPQ
QNASHSEGQGYGATLAAIFGDEEALRRIVDWTEANLARREDKLLSWRWLPGVALAVPDEN
NATDGDLFYAWGLAMAAQRFGKADYAGRATELARAIALHCVRPHPDGSEQLVLLPGASGF
ETPDGVVLNPSYYMPRALTELAAFSGQDRLARCARDGADWIASLGLPPDWALVTPFGTQP
APGLSHNSGYDALRVPLFLLWSGLTANPALRRAVEAAGDAAAGDTPVTFDRDTGAVLERS
ADPGFRAVLALGDCALSGRPGAAIPPFDARQPYYPATLHLMALVAQVEGFSACVPI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaggagacggaccatcctgacgtcggccgccgccgcgctgatgctggcgcctgcagga
cgcctcctcgcccagtcgggcggagaggccttgcctgcagaccacccgctccaggcggcc
tggcgcagttggaaggatgcgttcctgctgcccgccggccgcatcgtcgacgggccgcag
cagaatgcgagccattccgaagggcagggctacggagccacgctcgccgcgatcttcggc
gacgaggaggccctgcggcgcatcgtcgactggaccgaggcgaaccttgcgcggcgcgag
gacaagcttctgagctggcgctggctgcccggtgtggcgctggccgtgcctgacgagaac
aatgccaccgacggcgatctcttctacgcctggggtctcgccatggccgcgcagcggttc
ggcaaggccgattacgccgggcgggcgaccgaactggcgcgcgccatcgcgctgcattgc
gtgcgtccgcatccggacggctccgagcagctcgtgctgctgccgggggccagcggcttc
gagacgccggacggggtggtgctcaacccctcctactacatgccccgcgccctgaccgag
ctggccgccttcagcggccaggaccggctggcgcgctgtgcccgcgacggggcggactgg
atcgcgtcgctcgggcttccgccggactgggcgctggtgacgcccttcggcacacagccg
gcgccgggcctgtcccacaacagcggctacgatgcgctgcgggtgcccctgttcctgctc
tggtccgggctgaccgccaatccggcgctgcgccgcgcggtggaggcggccggggacgcc
gcagccggcgacacgccggtgacgttcgaccgcgacacgggggcggtgctggaacggtcc
gccgatccgggcttccgcgccgtgctcgcgcttggcgattgcgccctttcgggtcgtccg
ggggcggcgatcccgcccttcgacgcgcgccaaccctactatcccgcgacgctgcatctg
atggcgctcgtggcacaagtggaaggtttctccgcatgcgttccgatctga

DBGET integrated database retrieval system