KEGG   Rhodobacter sphaeroides KD131: RSKD131_1893Help
Entry
RSKD131_1893      CDS       T00844                                 

Definition
(GenBank) Holliday junction ATP-dependent DNA helicase ruvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RSKD131_1893
Enzymes [BR:rsk01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RSKD131_1893
DNA repair and recombination proteins [BR:rsk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     RSKD131_1893
    RecFOR pathway proteins
     RSKD131_1893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(1925800..1926474)
Genome map
AA seq 224 aa AA seqDB search
MIGKVAGILDFRGPDHVLIDVRGVGYIVYVSDRTLASMPGLGEAVALYTELVVREDLLQL
FGFPTMIEKEWHRLLMTVQGVGAKAGMAILGALGAEGTARAITLGDARSIQAAPGIGPKI
AQRVVLELKSKAPALMAMGGGTAALAPSEPPEPQPGTSSGSRRKTRAPEPPRPSHTADAL
SALANLGYQPTDAAQAVAQAAGESPDADTAALIRAALKLLAPKS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaaggtggcggggatcctcgacttccgcggcccggatcatgtgctgatcgac
gtccgcggcgtgggctacatcgtctatgtctccgaccggacgctggcctcgatgccgggt
ctgggcgaggcggtggctctctataccgagctcgtggtgcgcgaggatctgctgcagctc
ttcggcttccccacgatgatcgagaaggaatggcatcggctgctcatgacggtgcagggc
gtgggggccaaggccgggatggcgatcctcggagcgctcggggcggaagggaccgcgcgg
gcgatcacgctcggcgatgcgcgctcgatccaggccgcgccggggatcgggcccaagatc
gcgcagcgggtggtgctggagctgaagagcaaggcgcccgcgctgatggcaatgggcggc
ggcacggcggcgctggcgccctccgagcccccggagccccagcccggcacgtcgtccggc
agccgccgcaagacccgcgcgcccgagccgccgcggcccagccacacggccgacgcgctc
tcggccctcgccaatctcggctaccagccgaccgatgcggcgcaggccgtcgcgcaggcc
gcaggcgagagcccggacgccgatacggccgcgctgatccgggccgccctgaagctgctt
gcgccgaagtcataa

DBGET integrated database retrieval system