KEGG   Rhodobacter sphaeroides KD131: RSKD131_1893Help
Entry
RSKD131_1893      CDS       T00844                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rsk03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1925800..1926474)
Genome map
AA seq 224 aa AA seqDB search
MIGKVAGILDFRGPDHVLIDVRGVGYIVYVSDRTLASMPGLGEAVALYTELVVREDLLQL
FGFPTMIEKEWHRLLMTVQGVGAKAGMAILGALGAEGTARAITLGDARSIQAAPGIGPKI
AQRVVLELKSKAPALMAMGGGTAALAPSEPPEPQPGTSSGSRRKTRAPEPPRPSHTADAL
SALANLGYQPTDAAQAVAQAAGESPDADTAALIRAALKLLAPKS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaaggtggcggggatcctcgacttccgcggcccggatcatgtgctgatcgac
gtccgcggcgtgggctacatcgtctatgtctccgaccggacgctggcctcgatgccgggt
ctgggcgaggcggtggctctctataccgagctcgtggtgcgcgaggatctgctgcagctc
ttcggcttccccacgatgatcgagaaggaatggcatcggctgctcatgacggtgcagggc
gtgggggccaaggccgggatggcgatcctcggagcgctcggggcggaagggaccgcgcgg
gcgatcacgctcggcgatgcgcgctcgatccaggccgcgccggggatcgggcccaagatc
gcgcagcgggtggtgctggagctgaagagcaaggcgcccgcgctgatggcaatgggcggc
ggcacggcggcgctggcgccctccgagcccccggagccccagcccggcacgtcgtccggc
agccgccgcaagacccgcgcgcccgagccgccgcggcccagccacacggccgacgcgctc
tcggccctcgccaatctcggctaccagccgaccgatgcggcgcaggccgtcgcgcaggcc
gcaggcgagagcccggacgccgatacggccgcgctgatccgggccgccctgaagctgctt
gcgccgaagtcataa

DBGET integrated database retrieval system