KEGG   Rhodobacter sphaeroides KD131: RSKD131_1919Help
Entry
RSKD131_1919      CDS       T00844                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00010  Glycolysis / Gluconeogenesis
rsk00620  Pyruvate metabolism
rsk00640  Propanoate metabolism
rsk00680  Methane metabolism
rsk01100  Metabolic pathways
rsk01110  Biosynthesis of secondary metabolites
rsk01120  Microbial metabolism in diverse environments
rsk01130  Biosynthesis of antibiotics
rsk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSKD131_1919
   00620 Pyruvate metabolism
    RSKD131_1919
   00640 Propanoate metabolism
    RSKD131_1919
  Energy metabolism
   00680 Methane metabolism
    RSKD131_1919
Enzymes [BR:rsk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RSKD131_1919
Lipid biosynthesis proteins [BR:rsk01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RSKD131_1919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACM01779
UniProt: B9KKY2
Position
1:complement(1952382..1954343)
Genome map
AA seq 653 aa AA seqDB search
MDHAQANAVYTASADFIAQAHVDAAGYERMYAASVADPEAFWGEQGKRLDWIKPYTKVKN
TNFRPGEVSIKWFEDGTLNIAWNCIDRHLATRAKQTAIIWEPDDPNVPAQHISYQELHDN
VCRMANVLVSQGVRKGDRVVMYLPMIPEAAYAMLACARIGAIHSVVFAGFSPDALANRIN
DCQAKVVITADTAPRGGRRTPLKSNTDAALLHCSDRVRCLVVKHTGDQIHWMDGRDVDVK
ELMRHASPDCPIEEVNAEDPLFILYTSGSTGKPKGVVHTSGGYLTYAAMTHQMTFDYHDG
DVFWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPTYPDAGRFWAVCEKHKVNQFYTAP
TAIRSLMGLGPEWVDKYDLSSLKLLGSVGEPINPEAWSWYNTHVGKGRCPIVDTFWQTET
GGHMITPLPGAIPVKPGAASKPFFGVKPVILDPTDGHELHETATEGVLCIADSWPGQMRT
LWGDHERFEEAYFSQYKGYYFTGDGCRRDADGYYWVTGRVDDVINVSGHRMGTAEVESAL
VAHAQVAEAAVVGYPHDIKGQGIYAYVTLMNGVQPTEELRKDLVKWVRTEIGPIASPDVI
QWAPGLPKTRSGKIMRRILRKIAENDFGSLGDTTTLADPSVVDDLIANRKNRG
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgctcaggcgaatgcggtctataccgcgtcggcagatttcattgcgcaagcc
catgtcgacgcggccggctacgagcggatgtatgctgcatccgtggccgacccggaggcg
ttctggggcgaacagggcaagcggctcgactggatcaagccctacaccaaggtcaagaac
acgaacttccggccgggcgaggtctcgatcaagtggttcgaggacggcacgctgaacatc
gcctggaactgcatcgaccggcatctggcgacgcgcgccaagcagaccgcgatcatctgg
gagccggacgatccgaacgtgccggcccagcacatcagctatcaggagctgcacgacaac
gtctgccggatggcgaacgtgctggtgagccagggcgtgcgcaagggcgaccgggtggtg
atgtatctgccgatgattcccgaggccgcctatgcgatgctggcctgtgcccggatcggc
gccatccattccgtcgtcttcgcgggcttctcgccggatgcgctggcgaaccggatcaac
gactgtcaggccaaggtcgtgatcaccgccgacacggctccgcgcggcggccggcgcacg
cccttgaagtcgaacaccgacgcggcccttctccattgctcggaccgggtgcggtgcctc
gtcgtcaaacacacgggcgaccagatccactggatggacggccgcgacgtggacgtgaag
gagctgatgcgtcacgcctcgcccgactgcccgatcgaggaggtgaatgccgaggatccg
ctcttcatcctctatacctcgggctcgaccggcaagccgaagggggtcgtgcacacgtcg
ggcggctatctgacctatgccgccatgacccatcagatgaccttcgactaccatgacggc
gacgtcttctggtgcaccgcggacgtgggctgggtcacgggccacagctacatcgtctac
ggcccgctggcgaacggcgcgaccacgctcatgttcgagggcgtgccgacttatcccgat
gcgggccgcttctgggccgtctgcgagaagcacaaggtgaaccagttctacaccgcgccc
acggcgatccgctcgctgatgggcctcgggccggaatgggtcgacaagtacgacctgtcg
tcgctgaagctcctggggtcggtcggcgagccgatcaaccccgaggcctggagctggtac
aacactcatgtcggcaagggccgctgcccgatcgtcgacaccttctggcagaccgagacc
ggcggccacatgatcacgccgctgccgggcgcgatcccggtgaagccgggcgcggcctcg
aagcccttcttcggggtgaagccggtgatcctcgacccgaccgacgggcacgagctgcac
gagacggcgaccgagggggtgctctgcatcgccgacagctggccggggcagatgcggacg
ctctggggcgaccacgagcgcttcgaggaggcctatttctcgcagtacaagggctattac
ttcaccggcgacggctgccggcgggatgcggacggctactactgggtgacgggccgggtc
gatgacgtgatcaacgtctcgggccaccggatgggcacggccgaggtggaatcggcgctg
gtggcgcatgcccaggtggccgaggccgcggtggtgggctatccgcacgacatcaagggc
cagggcatctacgcctatgtcacgctgatgaacggggtccagccgaccgaggagctgcgc
aaggatctggtgaaatgggtccgcaccgagatcggccccatcgcctcgccggacgtgatt
cagtgggcgcccggcctgcccaagacccgctcgggcaagatcatgcgccgcatcctgcgc
aagatcgccgagaacgacttcggctcgctcggcgacaccacgacgctggccgacccgtcg
gtggtcgacgacctgatcgccaaccgcaagaaccggggctga

DBGET integrated database retrieval system