KEGG   Rhodobacter sphaeroides KD131: RSKD131_1986Help
Entry
RSKD131_1986      CDS       T00844                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSKD131_1986 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    RSKD131_1986 (hisD)
Enzymes [BR:rsk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     RSKD131_1986 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2019068..2020372)
Genome map
AA seq 434 aa AA seqDB search
MPQFLDTRRPGFEADFTALLGMKREDSPDVDAVVAGIIADVRARGDAAVIELTARFDRLE
LTPERLAFSEAEIEAEIATVSAEDRAALELAAERIRAYHARQMPEDARWTDAAGAELGWR
WGPIASAGLYVPGGLASYPSSVLMNAIPARVAGVERLVVACPTPGGVVNPLVLLAARLAG
VDAVYRIGGAQAVAALAYGTETIRPVDKITGPGNAYVAAAKRRVFGRVGIDMIAGPSEIL
VIAEGAVDPDWIALDLLSQAEHDESAQSILVTPDEALGRAVVQAVEARLETLERRAIAGA
SWRDYGAVIVTRDLEEAAALSDRVAPEHLELCVADPEALAARIRHAGAIFLGAWTPEAIG
DYVGGPNHVLPTARSARFSSGLSVMDFLKRTTLARMTPAALRAVGPAAERLAISESLEAH
GLSVRARLDRLNEG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgccccagtttctcgacacccgtcggcccggcttcgaggcggatttcaccgcgcttctc
ggcatgaagcgcgaggacagccccgatgtcgatgcggtggtggccgggatcatcgcggat
gtgcgggcgcgcggggatgcggcggtgatcgagctgaccgcgcggttcgaccggctggag
ctgacgcccgaacggcttgccttctcggaggcggagatcgaggcggagatcgcgaccgta
tctgccgaggaccgcgcggcgctggagctcgcggccgagcggatccgggcctatcacgcg
cgccagatgccggaggatgcgcgctggaccgatgcggccggcgccgaactcggctggcgc
tggggacctatcgcctcggccgggctctatgtgccgggggggcttgcctcctatccgtcc
tcggtgctgatgaatgcgatccccgccagggtcgccggggtggagcggctggtcgtggcc
tgcccgacgccgggcggcgtggtcaatccgctggtgctgctggccgcgcggctggcgggc
gtggatgccgtctaccggatcggcggggcgcaggcggtggcggcgctggcctacggcacc
gagacgatccggccggtggacaagatcaccggcccgggcaatgcctatgtggcggcggcc
aagcggcgggtcttcggccgggtggggatcgacatgattgcgggcccctccgagatcctc
gtgatcgcggaaggcgcggtcgatcccgactggatcgcgctcgaccttctgagccaggcc
gagcatgacgagagcgcgcagtcgatcctcgtcacgcccgacgaggcgctcggacgggcc
gtcgtgcaggcggtcgaggcgcggctcgagacgctcgagcggcgggcgatcgcgggcgcc
tcgtggcgcgactacggggcggtgatcgtgacgcgcgatctggaggaggcggcggcgctg
tcggaccgggtggcgcccgagcatctcgaactgtgcgtggccgatcccgaggcgctggcg
gcgcggatccgccatgcgggggcgatctttctcggcgcctggacgcccgaggcgatcggc
gactatgtgggcgggccgaaccatgtgctgcccaccgcccgctcggcgcgcttctcgagc
ggcctgtcggtgatggatttcctcaagcgcaccacgctcgcccggatgacgcccgcggcg
ctgcgcgccgtgggccccgccgccgagcggctggccatttcggagagcctcgaggcgcac
ggcctgtccgtccgcgcccggctcgaccggctgaacgagggctga

DBGET integrated database retrieval system