KEGG   Rhodobacter sphaeroides KD131: RSKD131_2063Help
Entry
RSKD131_2063      CDS       T00844                                 

Definition
cytochrome c-type cyt cy
Orthology
K08738  
cytochrome c
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Sulfur metabolism
Metabolic pathways
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rsk00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rsk02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2102694..2103218)
Genome map
AA seq 174 aa AA seqDB search
MFDTMTLTKAVGAGCGALLVFLLGSWAASGLYTFGEGHGEDVTQAYVIDTGASAAAEEPA
AEAVPFPELVAAADAAAGQKVFAKCAACHKVDGSDATGPHLNGVVDRAVASVAGFAYSDA
MVAHAAEAPTWTLEELGAFVENPKGHVPGTKMTFAGLPKEQDRANVVAYLASLQ
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacacgatgaccctgacgaaggcggtcggcgccgggtgcggcgcgctcctggtg
ttcctgcttggatcctgggcggccagcggcctttacaccttcggcgagggccacggcgag
gatgtgacgcaagcctatgtgatcgacacgggcgccagtgccgccgccgaggaaccggcc
gccgaagcggtgccgttcccggaactggtggctgcggccgatgcggcggcgggccagaag
gtcttcgcgaaatgcgccgcctgtcacaaggtcgacggctcggacgcgaccggcccgcat
ctgaatggtgtggtcgaccgcgcagtggcctcggtggcgggcttcgcctattcggacgcg
atggtggcccatgccgccgaggcgccgacctggacgctggaagagctcggcgccttcgtc
gagaatcccaagggccatgtgcctggcaccaagatgaccttcgcgggcctgccgaaagag
caggatcgcgccaatgtcgtggcctatctggcctcgctccagtaa

DBGET integrated database retrieval system