KEGG   Rhodobacter sphaeroides KD131: RSKD131_2198Help
Entry
RSKD131_2198      CDS       T00844                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00260  Glycine, serine and threonine metabolism
rsk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rsk01100  Metabolic pathways
rsk01110  Biosynthesis of secondary metabolites
rsk01130  Biosynthesis of antibiotics
rsk01230  Biosynthesis of amino acids
Module
rsk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSKD131_2198
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RSKD131_2198
Enzymes [BR:rsk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RSKD131_2198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ACM02058
UniProt: B9KMG7
Position
1:complement(2229693..2230484)
Genome map
AA seq 263 aa AA seqDB search
MTRIDDTFRRLRAEGKKAFVAYIMAGDPDLETSLAVMRGLPEAGVDIIELGMPFTDPMAD
GPTIQTAGQRALEGGQTLTRTLEMVRAFRAENAETPIVMMGYYNPIYARGVETFLAEATE
AGIDGLIVVDLPPEEDAELCLPAQAAGLNFIRLATPTTDSRRLPKVLQNTSGFVYYVSIT
GITGAAAAQAVDVAPEVARIKAATDLPVIVGFGITTPEAAQDLAGIADGCVVGSAIVKLV
GEGRPVAEVLDRVAALAAGAHAA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggatcgacgacaccttccggcggcttcgggccgaggggaagaaggccttcgtg
gcctatatcatggcgggcgatcccgatctcgagacgtcgcttgcggtgatgcggggcctg
ccggaggcgggcgtggacatcatcgagctgggcatgcccttcaccgatccgatggccgac
ggcccgacgatccagacggccggccagcgcgccctcgagggcggccagacgctgacccgg
acgctcgagatggtgcgcgccttccgggcggagaatgccgagacgcccatcgtgatgatg
ggttactacaatccgatctatgcgcgcggcgtcgagaccttcctcgccgaggcgacggag
gccgggatcgatgggctgatcgtggtggacctgccgcccgaggaggatgccgagctctgc
ctgcccgcacaggcggcggggctgaacttcatccggctcgcgacccccaccaccgacagc
cgccgcctgcccaaggtgctgcagaacacctcgggcttcgtctattacgtctcgatcacc
ggcatcaccggcgcggcggccgcgcaggcggtcgatgtggcgcccgaagtggcgcgcatc
aaggccgcgacggatctgccggtcatcgtgggcttcggcatcaccacccccgaggccgcg
caggacctcgccggtatcgccgacggctgcgtggtgggctcggcgatcgtgaagctcgtg
ggcgagggccggccggtggccgaggtgctggaccgggtggcggcgctcgcggccggcgct
cacgcggcctga

DBGET integrated database retrieval system