KEGG   Rhodobacter sphaeroides KD131: RSKD131_2198Help
Entry
RSKD131_2198      CDS       T00844                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSKD131_2198
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSKD131_2198
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RSKD131_2198
Enzymes [BR:rsk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RSKD131_2198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(2229693..2230484)
Genome map
AA seq 263 aa AA seqDB search
MTRIDDTFRRLRAEGKKAFVAYIMAGDPDLETSLAVMRGLPEAGVDIIELGMPFTDPMAD
GPTIQTAGQRALEGGQTLTRTLEMVRAFRAENAETPIVMMGYYNPIYARGVETFLAEATE
AGIDGLIVVDLPPEEDAELCLPAQAAGLNFIRLATPTTDSRRLPKVLQNTSGFVYYVSIT
GITGAAAAQAVDVAPEVARIKAATDLPVIVGFGITTPEAAQDLAGIADGCVVGSAIVKLV
GEGRPVAEVLDRVAALAAGAHAA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggatcgacgacaccttccggcggcttcgggccgaggggaagaaggccttcgtg
gcctatatcatggcgggcgatcccgatctcgagacgtcgcttgcggtgatgcggggcctg
ccggaggcgggcgtggacatcatcgagctgggcatgcccttcaccgatccgatggccgac
ggcccgacgatccagacggccggccagcgcgccctcgagggcggccagacgctgacccgg
acgctcgagatggtgcgcgccttccgggcggagaatgccgagacgcccatcgtgatgatg
ggttactacaatccgatctatgcgcgcggcgtcgagaccttcctcgccgaggcgacggag
gccgggatcgatgggctgatcgtggtggacctgccgcccgaggaggatgccgagctctgc
ctgcccgcacaggcggcggggctgaacttcatccggctcgcgacccccaccaccgacagc
cgccgcctgcccaaggtgctgcagaacacctcgggcttcgtctattacgtctcgatcacc
ggcatcaccggcgcggcggccgcgcaggcggtcgatgtggcgcccgaagtggcgcgcatc
aaggccgcgacggatctgccggtcatcgtgggcttcggcatcaccacccccgaggccgcg
caggacctcgccggtatcgccgacggctgcgtggtgggctcggcgatcgtgaagctcgtg
ggcgagggccggccggtggccgaggtgctggaccgggtggcggcgctcgcggccggcgct
cacgcggcctga

DBGET integrated database retrieval system