KEGG   Rhodobacter sphaeroides KD131: RSKD131_2356Help
Entry
RSKD131_2356      CDS       T00844                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00020  Citrate cycle (TCA cycle)
rsk00310  Lysine degradation
rsk01100  Metabolic pathways
rsk01110  Biosynthesis of secondary metabolites
rsk01120  Microbial metabolism in diverse environments
rsk01130  Biosynthesis of antibiotics
rsk01200  Carbon metabolism
Module
rsk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSKD131_2356
  Amino acid metabolism
   00310 Lysine degradation
    RSKD131_2356
Enzymes [BR:rsk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RSKD131_2356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H RnfC_N HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACM02216
UniProt: B9KNB0
Position
1:complement(2396718..2398250)
Genome map
AA seq 510 aa AA seqDB search
MMGTEVRVPTLGESVSEATVATWFKKPGDRVAADEMLCELETDKVTVEVHAPVAGRLVEI
VAPEGTTVAVSALLAQIGAAEAGEDPAPEKTHAGAEAKAGAGESKMIDVMVPALGESVSE
ATVSTWFKKPGDTVAQDEMLCELETDKVSVEVPAPAAGVLAEILVTEGTTVAAGSKLALI
SSDGQGVAAAPEAETPKKTEAAPAQEPAPKKDVEDAPSAKKAMAEAGLSPDAVQGTGRDG
RIMKDDVARAVAGASQAAAPAPAPQPALPRQPVPADDAAREERVKMTRLRQTIARRLKEA
QNTAAMLTTYNEVDMSGVMGLRNEYKDAFEKKHGTKMGFMSFFVKACCHALKEVPEVNAE
IDGTDIVYKNYVHMGVAVGTPSGLVVPVVRDADQMGFAQIEKKIAELGLRARDGKLSMAE
MQGGSFTISNGGVYGSLMSSPILNPPQSGILGMHKIQERPVVEKGQIVIRPMMYLALSYD
HRIVDGKGAVTFLVRVKEALEDPRRLLLDL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgatgggaacggaagtaagggttccgacgctgggagagagcgtctccgaggcgacggtc
gccacctggttcaagaagccgggcgacagggtcgctgccgacgagatgctctgcgagctc
gagaccgacaaggtgaccgtcgaggttcacgcgccggtcgcgggccggctggtcgagatc
gtcgccccggaggggacgacggttgcggtctcggcgcttctggcgcagatcggagcagcg
gaggccggcgaagatccggctccggagaagactcatgcgggcgccgaggcgaaggccggc
gcgggagagagcaagatgatcgacgtgatggtgcctgcccttggggaatcggtgtccgag
gcgaccgtgtccacctggttcaagaagccgggcgataccgtggcgcaggatgagatgctc
tgcgagctcgagaccgacaaggtctcggtcgaggtgccggcgcccgccgcgggcgtgctg
gccgagatcctcgtgacggagggcaccacggtggccgcgggctcgaagctcgcgctcatc
tcgtccgacgggcagggcgtggccgccgcgccagaggccgagacgccgaagaagaccgag
gccgcccccgcgcaggagcccgccccgaagaaggatgtcgaggatgcaccctcggccaag
aaggcgatggccgaggccggcctctcgcccgacgcggtgcagggcaccgggcgcgatggc
cgcatcatgaaggacgacgtggcccgcgccgtcgcgggcgcctcgcaggccgcggccccc
gcgcccgccccgcagcccgcgctgccgcgccagccggtcccggccgacgatgcggcgcgc
gaggagcgggtcaagatgacccgtctgcgccagaccatcgcccgccgcctgaaggaggcg
cagaacaccgccgccatgctcaccacctacaacgaggtggacatgtcgggcgtcatgggg
ctgcggaacgaatacaaggacgcgttcgagaagaagcacggcaccaagatgggcttcatg
tccttcttcgtgaaagcctgctgccatgcgctgaaggaagtgcccgaggtcaatgccgag
atcgacggcaccgacatcgtctacaagaactacgtccacatgggcgtggcggtgggcacc
ccctcgggcctcgtagtgccggtggtgcgcgacgccgaccagatgggcttcgcccagatc
gagaagaagatcgccgaactcgggctgcgcgcccgcgacggcaagctctcgatggccgag
atgcagggcggcagcttcaccatctcgaacggcggcgtctatggctcgctcatgtcctcg
ccgatcctgaacccgccgcagtcgggcatcctcggcatgcacaagatccaggagcggccg
gtggtcgagaagggccagatcgtcatccgcccgatgatgtatctcgcgctcagctacgat
caccgcatcgtcgatggcaagggcgcggtgaccttcctcgtccgcgtcaaggaggcgctc
gaggatccgcgccgcctgctgctcgacctctga

DBGET integrated database retrieval system