KEGG   Rhodobacter sphaeroides KD131: RSKD131_2356Help
Entry
RSKD131_2356      CDS       T00844                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RSKD131_2356
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSKD131_2356
  Amino acid metabolism
   00310 Lysine degradation
    RSKD131_2356
Enzymes [BR:rsk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RSKD131_2356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2396718..2398250)
Genome map
AA seq 510 aa AA seqDB search
MMGTEVRVPTLGESVSEATVATWFKKPGDRVAADEMLCELETDKVTVEVHAPVAGRLVEI
VAPEGTTVAVSALLAQIGAAEAGEDPAPEKTHAGAEAKAGAGESKMIDVMVPALGESVSE
ATVSTWFKKPGDTVAQDEMLCELETDKVSVEVPAPAAGVLAEILVTEGTTVAAGSKLALI
SSDGQGVAAAPEAETPKKTEAAPAQEPAPKKDVEDAPSAKKAMAEAGLSPDAVQGTGRDG
RIMKDDVARAVAGASQAAAPAPAPQPALPRQPVPADDAAREERVKMTRLRQTIARRLKEA
QNTAAMLTTYNEVDMSGVMGLRNEYKDAFEKKHGTKMGFMSFFVKACCHALKEVPEVNAE
IDGTDIVYKNYVHMGVAVGTPSGLVVPVVRDADQMGFAQIEKKIAELGLRARDGKLSMAE
MQGGSFTISNGGVYGSLMSSPILNPPQSGILGMHKIQERPVVEKGQIVIRPMMYLALSYD
HRIVDGKGAVTFLVRVKEALEDPRRLLLDL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgatgggaacggaagtaagggttccgacgctgggagagagcgtctccgaggcgacggtc
gccacctggttcaagaagccgggcgacagggtcgctgccgacgagatgctctgcgagctc
gagaccgacaaggtgaccgtcgaggttcacgcgccggtcgcgggccggctggtcgagatc
gtcgccccggaggggacgacggttgcggtctcggcgcttctggcgcagatcggagcagcg
gaggccggcgaagatccggctccggagaagactcatgcgggcgccgaggcgaaggccggc
gcgggagagagcaagatgatcgacgtgatggtgcctgcccttggggaatcggtgtccgag
gcgaccgtgtccacctggttcaagaagccgggcgataccgtggcgcaggatgagatgctc
tgcgagctcgagaccgacaaggtctcggtcgaggtgccggcgcccgccgcgggcgtgctg
gccgagatcctcgtgacggagggcaccacggtggccgcgggctcgaagctcgcgctcatc
tcgtccgacgggcagggcgtggccgccgcgccagaggccgagacgccgaagaagaccgag
gccgcccccgcgcaggagcccgccccgaagaaggatgtcgaggatgcaccctcggccaag
aaggcgatggccgaggccggcctctcgcccgacgcggtgcagggcaccgggcgcgatggc
cgcatcatgaaggacgacgtggcccgcgccgtcgcgggcgcctcgcaggccgcggccccc
gcgcccgccccgcagcccgcgctgccgcgccagccggtcccggccgacgatgcggcgcgc
gaggagcgggtcaagatgacccgtctgcgccagaccatcgcccgccgcctgaaggaggcg
cagaacaccgccgccatgctcaccacctacaacgaggtggacatgtcgggcgtcatgggg
ctgcggaacgaatacaaggacgcgttcgagaagaagcacggcaccaagatgggcttcatg
tccttcttcgtgaaagcctgctgccatgcgctgaaggaagtgcccgaggtcaatgccgag
atcgacggcaccgacatcgtctacaagaactacgtccacatgggcgtggcggtgggcacc
ccctcgggcctcgtagtgccggtggtgcgcgacgccgaccagatgggcttcgcccagatc
gagaagaagatcgccgaactcgggctgcgcgcccgcgacggcaagctctcgatggccgag
atgcagggcggcagcttcaccatctcgaacggcggcgtctatggctcgctcatgtcctcg
ccgatcctgaacccgccgcagtcgggcatcctcggcatgcacaagatccaggagcggccg
gtggtcgagaagggccagatcgtcatccgcccgatgatgtatctcgcgctcagctacgat
caccgcatcgtcgatggcaagggcgcggtgaccttcctcgtccgcgtcaaggaggcgctc
gaggatccgcgccgcctgctgctcgacctctga

DBGET integrated database retrieval system