KEGG   Rhodobacter sphaeroides KD131: RSKD131_2367Help
Entry
RSKD131_2367      CDS       T00844                                 

Definition
Succinate dehydrogenase subunit D
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:rsk01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rsk00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rsk00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:rsk00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2408828..2409199
Genome map
AA seq 123 aa AA seqDB search
MRFITARKRAEGMGAAHHGTDRHWYMIVSAVGLAVLIPIFVYIVGNAIGEGRERVLEIFS
HPFNAILSGLVLFFGMRHFAEGSTMMIEDYWQGVPRRLLVICAQSFAYGVAAIGLFALAK
IAL
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcatcaccgcccgcaagcgcgccgaaggcatgggtgccgcccatcacggcacc
gaccggcactggtacatgatcgtgagcgcggtgggcctcgccgtgctgatcccgatcttc
gtctatatcgtcggcaatgccatcggcgaaggccgcgagcgcgtgctcgagatcttctcg
cacccgttcaatgcgatcctgtcgggcctcgtgctgttcttcggcatgcgccacttcgcc
gagggttcgaccatgatgatcgaggactactggcagggcgtgccgcggcgcctgctggtg
atctgcgcccaatccttcgcctatggcgtggcggcgatcgggctgttcgccctcgccaag
atcgccctctga

DBGET integrated database retrieval system