KEGG   Rhodobacter sphaeroides KD131: RSKD131_2394Help
Entry
RSKD131_2394      CDS       T00844                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rsk00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rsk00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2433646..2434608
Genome map
AA seq 320 aa AA seqDB search
MTFRARHLLGIEHLAPDEIRSVLDLADSYVDLNRRTMKQSDALAGMTQINMFFENSTRTQ
SSFELAGKRLGADVMNMAVAQSSVKKGETLLDTAMTLNAMHPDLLVVRHPASGAVNLLAS
KVNCAVLNAGDGRHEHPTQALLDALTIRRAKGRIQRLTVAICGDIAHSRVARSNLILLGK
MENRVRLIAPPTLMPPGVGEFGCELYDDMKKGLEGADVVMMLRLQKERMDGAFIPSEREY
YHRFGLDAEKLAFAKEDAIVMHPGPMNRGVEIDGTLADDINRSVIQDQVEMGVAVRMACM
DLLARNLRAERGRAAVGVMA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaccttccgcgcccgccacctgctcggcatcgagcatctggcccccgacgagatccgc
tccgtcctcgacctcgccgacagttatgtggacctcaaccgccgcacgatgaagcagtcg
gacgcgctggcggggatgacccagatcaacatgttcttcgagaattccacccgcacccag
tcgagcttcgagcttgcgggcaagcggctcggcgcggatgtgatgaacatggccgtggcg
cagagctcggtgaagaagggcgagacgctccttgacaccgccatgacgctgaacgcgatg
caccccgatctcctcgtggtgcgccacccggcctcgggggcggtcaacctcctggcctcc
aaggtgaattgcgccgtcctcaatgcgggcgacgggcggcacgaacatccgacgcaggcg
cttctcgatgcgctcaccatccgccgcgccaagggccgcatccagcgcctgaccgtcgcc
atctgcggcgacatcgcccacagccgggtggcgcgctcgaacctgatcctgctcggcaag
atggagaaccgcgtgcgcctgatcgcgccgcccacgctgatgccgccgggggtgggcgag
ttcggctgcgagctgtacgacgacatgaagaagggcctcgaaggcgccgatgtggtgatg
atgctgcgcctccagaaagagcggatggacggggccttcatcccctccgagcgcgaatat
taccaccgcttcggtctcgacgccgagaagctcgccttcgccaaggaggatgcgatcgtc
atgcatccgggccctatgaaccgcggtgtcgagatcgacggcacgctcgccgacgacatc
aaccgctcggtgatccaggatcaggtcgagatgggggtggcggtgcgcatggcctgcatg
gatcttctggcgcggaacctgcgcgccgaacggggccgcgcggccgtgggggtgatggca
tga

DBGET integrated database retrieval system