KEGG   Rhodobacter sphaeroides KD131: RSKD131_2573Help
Entry
RSKD131_2573      CDS       T00844                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RSKD131_2573
   00051 Fructose and mannose metabolism
    RSKD131_2573
Enzymes [BR:rsk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     RSKD131_2573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2617099..2618400)
Genome map
AA seq 433 aa AA seqDB search
MTDFFAGIPQIRYEGEGSSNEFAFRHYNPDEVILGKRMEDHLRFAVAWWHSFAWPGGDPF
GGQTFDRPWFGDTLDLAKLKADVAFEMFDILGAPFFCFHDADIRPEGATFAESKRNLEEI
VDHIGTRMEGSKTKLLWGTANLFSHRRFMSGAATNPDPDVFAWSAATVKGCMDATMKLGG
ANYVLWGGREGYETLLNTDLTREAENAGRFLQMVVDYKHKIGFQGTILIEPKPQEPSKHQ
YDYDVATVYGFLKRFGLEKEVKLNIEQGHAILAGHSFEHELALAASLGILGSIDMNRNDY
QSGWDTDQFPHNHPEMALAYYEILRAGGFTTGGTNFDAKIRRQSLDPEDLVLAHVGGMDT
CARALKAAARLYEDGSLETARAARYAGWETPEAQAMLASSLEEIEARVLAEGINPKPRSG
RQERLENLWNRFV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacttcttcgcgggtatcccgcagatccgctacgagggcgaaggctcctccaac
gaattcgccttccgccactacaatcccgacgaggtgatcctcggcaagcggatggaagac
catctgcgatttgcggtcgcctggtggcacagcttcgcctggccgggcggcgatccgttc
ggcggccagaccttcgaccggccgtggttcggcgatacgctggacctcgcaaagctcaag
gccgacgtggccttcgagatgttcgacatcctcggcgcgcccttcttctgcttccacgat
gccgacatccgcccggaaggcgcgaccttcgccgaaagcaagcgcaacctcgaggagatc
gtcgaccatatcggcaccagaatggaggggtcgaagacgaagctcctctggggcacggcg
aacctcttctcgcaccgccgcttcatgtcgggcgcggccaccaaccccgaccccgacgtc
ttcgcctggtcggcggccacggtgaagggctgcatggacgcgacgatgaagctcggcggc
gcgaactatgtgctctggggcgggcgcgagggctacgagacgctgctcaacaccgacctc
acccgcgaggccgagaatgcgggccgcttcctgcagatggtggtggattacaagcacaag
atcggtttccagggcacgatcctgatcgagccgaagccgcaggagccctcgaagcaccag
tacgactatgacgtggcgacggtctacggcttcctcaagcgtttcggcctcgagaaggaa
gtgaagctcaacatcgagcagggccacgcgatcctcgccggccacagtttcgagcacgag
ctggcgctggcggcgagcctcggcatcctcggctcgatcgacatgaaccggaacgactat
cagtcgggctgggataccgatcagttcccgcacaaccaccccgagatggccttggcctat
tacgagatcctgcgggcgggcggcttcaccacgggcggcacgaacttcgacgcgaagatc
cgccgccagagcctcgatcccgaggatctcgtgctggcccatgtgggcggcatggacacc
tgcgcccgtgcgctgaaggccgcggcgcggctctatgaggatggaagcctcgagaccgcg
cgcgccgcgcgctatgcgggctgggaaacgcccgaggcgcaggcgatgctcgcctcctcg
ctggaggagatcgaggcccgcgtgctggccgagggaatcaaccccaagccgcgctcgggc
cggcaggagcggctggaaaacctctggaaccgcttcgtctga

DBGET integrated database retrieval system