KEGG   Rhodobacter sphaeroides KD131: RSKD131_2614Help
Entry
RSKD131_2614      CDS       T00844                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RSKD131_2614
Enzymes [BR:rsk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RSKD131_2614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2659936..2660793)
Genome map
AA seq 285 aa AA seqDB search
MMLLNLGSINIDHVYRMPHLPAPGETLEAESYSVGLGGKGANQSVAAARAGARILHVGAV
GSEGRWARDWMAAAGVDVTHVAVGEVATGHAIINVDEEAENTIVIFPGANRTLDAATVTA
ALAAAGPGDTLLLQNETSAQVEAARLASQRGLKVIYCAAPFEIGSVRAVLPYVSLLVMNE
GEAAALKAALGALPEVPMVVTLGARGAEWLVPGEDRLSVPAFPVTAVDTVGAGDCFTGNL
AAALDAGLDPAEAMRRASAAAALQVTRPGAAEAMPKADEVDAFLG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgatgctgctcaatctgggctcgatcaacatcgaccatgtctaccggatgccgcatctg
ccggcgcccggagagacgctcgaggccgaaagctacagcgtgggtctcggcggcaagggc
gcaaaccagtccgtcgccgcggcgcgggccggggcacggatccttcatgtcggcgcggtc
gggtccgaggggcgctgggcgcgcgactggatggctgcggcgggcgtcgacgtcacccat
gtggcggtgggggaggtcgccaccggccatgccatcatcaacgtggatgaagaggccgag
aacaccatcgtgatctttccgggcgccaaccggacgctcgatgcggccacggtgacggcg
gcgctcgccgcggcgggcccgggcgatacgctccttctgcagaacgagacctcggcgcag
gtcgaggcggcgcgtctggcttcgcagcgcggcctgaaggtgatctactgcgccgccccg
ttcgagatcgggtccgtgcgggccgttctgccctacgtcagcctcctcgtgatgaacgag
ggcgaagcggcggcgctgaaagccgcgctcggggcgctgcccgaggtgccgatggtcgtg
acactcggcgcccggggtgccgaatggctcgtgccgggcgaggatcggctctccgttccc
gcttttcccgtgaccgccgtcgacacggtgggtgcgggcgactgtttcacgggaaacctt
gccgcggcgctcgatgcggggctcgacccggcggaggcgatgcgccgggcatccgcggcc
gccgcgcttcaggtcacgcgtccgggcgcggccgaggccatgcccaaggccgacgaggtg
gatgccttcctcggctga

DBGET integrated database retrieval system