KEGG   Rhodobacter sphaeroides KD131: RSKD131_2739Help
Entry
RSKD131_2739      CDS       T00844                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    RSKD131_2739
Enzymes [BR:rsk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     RSKD131_2739
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     RSKD131_2739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2781748..2782599
Genome map
AA seq 283 aa AA seqDB search
MPELPEVETVRRGLEPAMAGRLIAEARVNRADLRWPFPPRMAERLTGQRVLRLRRRSKYI
LADLSGGQSLLIHLGMSGRMLVSGAQLGEFFHDHPAPSRHDHVVLEMEGGARITFNDARR
FGAMDLVATEAAEAHPLLAVLGPEPLGNAFDGAYLAARLEGRRTPIKAALLDQRIVAGLG
NIYVCEVLFRAGLAPGRLAGSLSRAESEGLVPLIREVLLEAIEAGGSSLRDYRQADGELG
YFQHTFRVYGREGLPCVTPGCSGTVGRIVQSGRSSFHCPLCQR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcttccagaagtcgaaactgtgcgccgggggctcgagcccgcgatggctggc
aggctgatcgccgaggcgcgggtgaaccgcgcggatctgcgctggccctttcccccgcgc
atggccgagcggctgacggggcagcgggttctgcggctgcggcggcggtcgaaatacatt
ctcgcggacctctcggggggccagtcgctgctgatccatctcggcatgtcggggcggatg
ctggtctcgggcgcgcagctgggagagttcttccacgaccatcccgcgccctcgcgtcac
gatcatgtggtgctggagatggaggggggcgcgcgcatcaccttcaacgatgcgcgccgc
ttcggcgcgatggatctggtggcgaccgaagcggccgaggcccatccgctgcttgccgtg
ctgggtcccgagccgctcggcaacgccttcgacggcgcctatctcgcggcccggctcgag
gggcggcggacgccgatcaaggcggcccttctcgaccagcggatcgtggcgggcctcggc
aacatctatgtctgcgaggtgctgttccgcgcaggcctggcgcccggccgcctggcgggc
agcctgagccgcgccgagtccgagggccttgtgccgctgatccgcgaggtgctccttgag
gcgatcgaggcgggcggatcctcgttgcgcgactaccgtcaggcggatggcgaactcggc
tactttcagcacacgttcagggtgtacggacgcgagggtttaccctgcgtgacgcccggt
tgctccggcaccgtggggcggatcgtgcagtcgggacgctcgtccttccactgcccgctc
tgccagagatga

DBGET integrated database retrieval system