KEGG   Rhodobacter sphaeroides KD131: RSKD131_2767Help
Entry
RSKD131_2767      CDS       T00844                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    RSKD131_2767
Enzymes [BR:rsk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     RSKD131_2767
    3.5.1.-  
     RSKD131_2767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2819669..2820274)
Genome map
AA seq 201 aa AA seqDB search
MRPQTEALIVIDVQNDFCPGGALAVAGGDAIIPRINALLPEFGARIFTQDWHPADHSSFA
STHEAVPFSLIEMPYGPQVLWPTHCVQGTRGAEFHPALETAPADLVLRKGFRRDIDSYSA
FFENDRTTPTGLEGYLRSRGIEAVTLAGLATDFCVAYSALDAARLGFRVTVLEGASAAID
LNGSLAAIKAQMAEAGVSLEP
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccccagaccgaagccctgatcgtgatcgacgtgcagaacgacttctgcccgggc
ggcgcgctcgccgtcgccggaggggacgcgatcatcccccggatcaatgcgctcctgccc
gagttcggcgcgcgcatcttcacgcaggactggcatccggcagaccattcctccttcgct
tccacccacgaggcagtgccgttctcgctgatcgagatgccctacgggccgcaggtgctc
tggcccacccattgcgtgcagggcacgcgcggcgccgagttccatcccgcgctcgagacg
gcgccggccgatctcgtcctccgcaagggcttccgtcgcgacatcgacagctactcggcc
ttcttcgagaacgaccgcaccacccccaccggcctcgagggctacctgcgcagccgcggg
atcgaggcggtgacgctcgcgggcctcgccaccgacttctgcgtggcctattccgcgctc
gatgccgcccgactgggcttccgggtgacggtgctggaaggcgcctcggccgccatcgac
ctcaacggatcgctcgccgcgatcaaggcgcagatggccgaggccggcgtctcgctggag
ccctga

DBGET integrated database retrieval system