KEGG   Rhodobacter sphaeroides KD131: RSKD131_2907Help
Entry
RSKD131_2907      CDS       T00844                                 

Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSKD131_2907
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSKD131_2907
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RSKD131_2907
Enzymes [BR:rsk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RSKD131_2907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2961796..2963001
Genome map
AA seq 401 aa AA seqDB search
MSAYLKSHPTHDGFFGPYGGAMLPPPLEPHFAAIREAYGRISKSADFIAELRYIRKHFQG
RPTPVSHLKNLSALCGGAQIYAKREDLNHTGAHKLNHCMAEGLLARFMGKTKLMAETGAG
QHGVALATAAAYFGMECEIHMGEIDIAKEAPNVTRMKLLGATVVPVGFGGRSLKEAVDSC
FQSYLAQADTALFAIGSVVGPHPFPMMVRDFQHVVGVEAREQFLEMTGELPDMVAACVGG
GSNAMGIFSGFLDDDVALYGIEPCGTSSKLGDHAATIAYGEDGDIHGFRTMVLKDAEGNP
APVHTVASGLDYPGVGPEHAFLHRSGRVTYTGADDREALAAFFALSRHEGIIPALESAHA
VAFAMREAKAHPGKSILVNLSGRGDKDIDYVTQTFGFGETA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcctatctgaaatcccacccgacccacgacggcttcttcggcccctacggaggc
gccatgctgccgcctccgctcgagccccatttcgccgccatccgcgaggcctatggccgg
atctcgaaatcggccgatttcatcgccgagctgcgctacatccgcaagcatttccagggc
cggcccacgccggtctcccacctgaagaacctctcggcgctctgcggcggcgcccagatc
tatgccaagcgcgaggatctgaaccacaccggcgcgcacaagttgaaccactgcatggcc
gaggggctgctggcgcgcttcatgggcaagaccaagctgatggccgagacgggcgcgggc
cagcacggcgtggcgctggccacggccgcggcctatttcggcatggaatgcgagatccac
atgggcgagatcgacatcgccaaggaggcgccgaacgtcacgcgcatgaagcttctgggc
gccacggtggtgccggtgggcttcggcggccgctcgctgaaggaggcggtcgacagctgc
ttccagagctacctcgcccaggccgacacggcgctcttcgccatcggctcggtcgtgggt
ccgcatccgttcccgatgatggtacgcgacttccagcatgtggtgggggtcgaggcacgc
gagcagttcctcgagatgacgggcgagctgcccgacatggtggcggcctgcgtgggcggc
ggatcgaacgcgatggggatcttctcgggcttcctcgacgacgacgtggcgctctacggg
atcgagccctgcggcacctcctcgaagctcggcgaccatgcggcgacgatcgcctacggc
gaggacggcgacatccacggcttccgcaccatggtgctgaaggatgccgagggcaatccg
gcgccggtccataccgtggcctccggtctcgattatccgggcgtcggccctgagcatgcc
ttcctgcaccgctccgggcgcgtgacctataccggcgccgacgaccgcgaggcgctcgcg
gccttcttcgccctctcgcgccacgagggcatcatccccgccctcgaaagcgcccatgcc
gtggccttcgccatgcgcgaggcgaaggcccatccgggcaagtcgatcctcgtcaacctc
tcggggcgcggcgacaaggacatcgactacgtcacccagaccttcggcttcggcgagacc
gcctga

DBGET integrated database retrieval system