KEGG   Rhodobacter sphaeroides KD131: RSKD131_2907Help
Entry
RSKD131_2907      CDS       T00844                                 

Definition
(GenBank) Tryptophan synthase, beta subunit
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSKD131_2907
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSKD131_2907
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RSKD131_2907
Enzymes [BR:rsk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RSKD131_2907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:2961796..2963001
Genome map
AA seq 401 aa AA seqDB search
MSAYLKSHPTHDGFFGPYGGAMLPPPLEPHFAAIREAYGRISKSADFIAELRYIRKHFQG
RPTPVSHLKNLSALCGGAQIYAKREDLNHTGAHKLNHCMAEGLLARFMGKTKLMAETGAG
QHGVALATAAAYFGMECEIHMGEIDIAKEAPNVTRMKLLGATVVPVGFGGRSLKEAVDSC
FQSYLAQADTALFAIGSVVGPHPFPMMVRDFQHVVGVEAREQFLEMTGELPDMVAACVGG
GSNAMGIFSGFLDDDVALYGIEPCGTSSKLGDHAATIAYGEDGDIHGFRTMVLKDAEGNP
APVHTVASGLDYPGVGPEHAFLHRSGRVTYTGADDREALAAFFALSRHEGIIPALESAHA
VAFAMREAKAHPGKSILVNLSGRGDKDIDYVTQTFGFGETA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcctatctgaaatcccacccgacccacgacggcttcttcggcccctacggaggc
gccatgctgccgcctccgctcgagccccatttcgccgccatccgcgaggcctatggccgg
atctcgaaatcggccgatttcatcgccgagctgcgctacatccgcaagcatttccagggc
cggcccacgccggtctcccacctgaagaacctctcggcgctctgcggcggcgcccagatc
tatgccaagcgcgaggatctgaaccacaccggcgcgcacaagttgaaccactgcatggcc
gaggggctgctggcgcgcttcatgggcaagaccaagctgatggccgagacgggcgcgggc
cagcacggcgtggcgctggccacggccgcggcctatttcggcatggaatgcgagatccac
atgggcgagatcgacatcgccaaggaggcgccgaacgtcacgcgcatgaagcttctgggc
gccacggtggtgccggtgggcttcggcggccgctcgctgaaggaggcggtcgacagctgc
ttccagagctacctcgcccaggccgacacggcgctcttcgccatcggctcggtcgtgggt
ccgcatccgttcccgatgatggtacgcgacttccagcatgtggtgggggtcgaggcacgc
gagcagttcctcgagatgacgggcgagctgcccgacatggtggcggcctgcgtgggcggc
ggatcgaacgcgatggggatcttctcgggcttcctcgacgacgacgtggcgctctacggg
atcgagccctgcggcacctcctcgaagctcggcgaccatgcggcgacgatcgcctacggc
gaggacggcgacatccacggcttccgcaccatggtgctgaaggatgccgagggcaatccg
gcgccggtccataccgtggcctccggtctcgattatccgggcgtcggccctgagcatgcc
ttcctgcaccgctccgggcgcgtgacctataccggcgccgacgaccgcgaggcgctcgcg
gccttcttcgccctctcgcgccacgagggcatcatccccgccctcgaaagcgcccatgcc
gtggccttcgccatgcgcgaggcgaaggcccatccgggcaagtcgatcctcgtcaacctc
tcggggcgcggcgacaaggacatcgactacgtcacccagaccttcggcttcggcgagacc
gcctga

DBGET integrated database retrieval system