KEGG   Rhodobacter sphaeroides KD131: RSKD131_2986Help
Entry
RSKD131_2986      CDS       T00844                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RSKD131_2986
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RSKD131_2986
Enzymes [BR:rsk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RSKD131_2986
Two-component system [BR:rsk02022]
 CheA family
  CheA-CheYBV
   RSKD131_2986
Bacterial motility proteins [BR:rsk02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RSKD131_2986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3040802..3041842
Genome map
AA seq 346 aa AA seqDB search
MFKVIVESDPALQVMAAVPDAYAAARAMRTELPDVILLDLELPGMDGLTFLRKIMQQHPI
PVVVCSSHVGAGTEAMVSALELGAREVISKPAARNDLERQEASIRICDAIRAATETTRRR
TQPEPRPLAPGPKLTADEILPARPPRPVPETTPVVCIGASTGGTEALRDVLTALPASAPP
IVIVQHMPRGFTAAFARRLDSLCAIEVLEAEDEMQVMPGRAIIAQGDRHLLLRRRNQGYR
VSVLDGAYVCRHRPSVDVLFRSAAQEAGGNALGVIMTGMGDDGARCMAEMRAAGAETIAQ
NEESCVVYGMPREAVAHGGVGKVEPLDRLAARIMEFGRRHTERTVR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaggtgatcgtcgagagcgatccggcgcttcaggtcatggcagccgtccccgac
gcctatgcggctgcccgggctatgcgaacggaactgcccgacgtgatcctgctcgacctc
gagcttccaggcatggatggcctgaccttcctgcgcaagatcatgcagcagcacccgatc
ccggtggtcgtctgttcgagccatgtcggagccggcaccgaggcgatggtctctgctctg
gaactgggcgcgcgcgaggtgatttccaagcctgccgcccggaacgacctcgaacgccag
gaagcctcgatccggatctgtgacgcgatccgcgccgcaaccgagacgacgcgccgccgc
actcagcctgagccgcgtcccctggcgcctggccctaaactcaccgccgacgagatcctg
cccgcgcgcccgccgcgtccggtgcccgagacgacgcccgtcgtttgcatcggcgcctcg
actggcggaacggaagccctgcgggacgttctcacggcactgcccgcctccgcgccgccg
atcgtgatcgtccagcacatgccgcgcggcttcactgccgccttcgcgcgccggctcgac
tcgctctgcgccatcgaggtactggaggcggaggatgagatgcaggtcatgcccggccgc
gccatcatcgcgcagggcgaccgccacctgctgcttcggcgccgcaatcagggctaccgc
gtgtcggtgctggatggcgcctacgtctgccgccaccgaccctctgtcgatgtgctcttc
cgctcggcggcgcaggaagcgggcgggaacgcgctcggtgtcatcatgacgggcatgggt
gacgacggagcgcgctgcatggccgagatgcgtgcggccggcgcggaaaccattgcccag
aacgaagaaagctgcgtcgtctacggaatgccgcgcgaggcggtggcccatggcggggtc
gggaaggtagagcctctggacaggctcgcggcccggatcatggaattcggccggcgccac
acggaaaggaccgtccgatga

DBGET integrated database retrieval system