KEGG   Rhodobacter sphaeroides KD131: RSKD131_2995Help
Entry
RSKD131_2995      CDS       T00844                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RSKD131_2995 (deoA)
Enzymes [BR:rsk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     RSKD131_2995 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3051778..3053085
Genome map
AA seq 435 aa AA seqDB search
MDARSINAKLRRGEVPSASELGWFAEGLASGHVTDAQAGAFAMAVCLQGLGEEGRVGLTR
AMRDSGRVLAWDLPGPVLDKHSTGGIGDCTSLLLAPALAACGAYVPMISGRGLGHTGGTL
DKLEAIPGFRVALGEERLRAQIEDVRCAIVAADEGMAPADRRLYLIRDVTGTVESIDLIT
ASILSKKLAAGLEGLVLDVKVGSGAFMKSMDEAEALARALVGTAQGAGCMTSALITDMSQ
PLATAAGNALEVIEVMETLTGTSINAALWDVTVALGGEALALGGLAADAEDGAHRIEQAL
ESGHAAEFFARMVAAQGGPVDFVERWPDRLPSAPVMREVPSLRTGFVLRIDTAALGQAVV
HLGGGRLRETDRVNPSVGLADIAGIGEEVSEDLPLAMIHAATEADADAAVAAIQAAYVIS
DQEPAEPPLIHARIA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtggacgcgcgatcgatcaacgcaaagctgcgcaggggcgaagtgccctcggcctccgaa
ctgggctggttcgcggaaggtctggcctcgggccatgtcaccgacgcgcaggccggtgcc
ttcgccatggcggtctgcctgcaggggctgggcgaggaggggcgggtgggcctgacgcgc
gccatgcgcgactccggccgggtgctcgcctgggacctgccggggccggtgctcgacaaa
cattcgacgggcggcatcggcgactgcacctcgctgctcctcgcgccggctctggctgcc
tgcggggcctatgtgccgatgatctcgggccgggggctcggccatacggggggcacgctc
gacaagctggaagcgatcccgggcttccgcgtggccctgggcgaagagcggctgcgcgcg
cagatcgaggatgtccgctgcgccatcgtcgccgccgacgagggcatggcgcccgcggac
cggcggctctacctcatccgcgacgtgaccggcacggtcgaatcgatcgacctcatcacc
gcgtcgatcctgtcgaagaagctggcggccgggctcgaggggctggtgctcgatgtgaaa
gtgggctcgggcgccttcatgaagtcgatggacgaggccgaagcgctggcgcgcgctctg
gtgggcacggcgcagggggcaggctgcatgacatcggccctcatcaccgacatgagccag
ccgctcgcgaccgcggccggcaatgcgctcgaggtgatcgaggtgatggagacgctgacc
ggcacctcgatcaacgcggccctctgggacgtgacggtggcgctcggcggcgaggccctg
gcgctgggtgggcttgccgccgacgccgaggacggggcgcaccggatcgagcaggcgctg
gaaagcggacacgcggccgagttcttcgcccgcatggtggcggcgcagggcgggccggtc
gatttcgtcgaacgctggcccgaccggctgccctcggcccccgtgatgcgcgaggtgccg
agcctgcgcacgggcttcgtgctgcgcatcgacacggcggcgctcggtcaggcggtggtg
catctgggcggagggcggctgcgcgagaccgaccgggtgaatccctcggtgggcctggcc
gacatcgctgggatcggcgaggaagtgtccgaggatctgccgctcgccatgatccatgcc
gcgaccgaggccgatgccgatgccgctgtggccgcgattcaggcggcctatgtgatctcg
gatcaggagccggccgagccgccgctcatccatgcgaggattgcctga

DBGET integrated database retrieval system