KEGG   Rhodobacter sphaeroides KD131: RSKD131_3068Help
Entry
RSKD131_3068      CDS       T00844                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RSKD131_3068
Enzymes [BR:rsk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     RSKD131_3068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3122173..3122535
Genome map
AA seq 120 aa AA seqDB search
MDPRKILARLHEIEADFGRSRSHRWADRTLDLDLIALDDSVWPDADTQERWRHLPPEEQA
RRTPDGLILPHPRLQDRAFVLVPLADVAPDWRHPLLGLTVREMLAALPEAERAAAVPLGA
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
gtggatccccgcaagatcctcgcacgtctgcacgagatcgaggcggattttggccgatcg
cggtcgcaccgatgggccgaccggacgctcgacctcgatctgatcgccctggatgattcg
gtctggcccgacgccgacacccaggagcggtggaggcaccttcctcccgaggagcaggcc
cgccgcacgccggacgggctcatattgccgcacccccgacttcaggaccgggccttcgtg
ctcgtcccgctggccgacgtggcgcccgactggcgtcatccgctgctcggcctgacggtg
agagagatgctcgcggcgctgcccgaggcggagcgggccgccgctgtgccgctcggggct
tga

DBGET integrated database retrieval system