KEGG   Rhodobacter sphaeroides KD131: RSKD131_3149Help
Entry
RSKD131_3149      CDS       T00844                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSKD131_3149
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RSKD131_3149
Enzymes [BR:rsk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     RSKD131_3149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:43774..44898
Genome map
AA seq 374 aa AA seqDB search
MATLMPLQAPDIRSAKRLVVKIGSALLVDGEGLRRQWLSALALDVAEARTRGTQVILVSS
GSIALGRRVLHLPPGPLALEQSQAAAAVGQIRLARAYEEVLAPHGITTAQVLVTLEDTED
RRRYLNSRATMETLLGLGTVPIVNENDTVATDEIRFGDNDRLAAQIAVTVGADQLVLLSD
VDGFYSANPKEDPTAERFDLVETITPALEAMAGDPVSGLSKGGMKTKIMAAKTAVAGGCA
MAITEGSAMRPLKALEQGAARTWFVAQGDPQAARKRWINAMKPRGTIRVDAGAVQALQAG
KSLLPAGVVAVEGNFGRGDPVEIAGPMGEVLGRGLTRYTAVEAVQIAGHRSAEIEGILGY
SGRAALIHRDDMVI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaccctgatgccgcttcaggcgccggatatccgcagcgccaagcgtctggtcgtg
aagatcggctcggcgctcctcgtggatggcgaggggctgcgtcgccagtggctctcggcg
ctggcgctcgacgtggccgaggcgcggacgcggggcacgcaggtgatcctcgtctcctcg
ggctcgatcgcgctcgggcggcgggtgctgcatctgccgccggggccgctcgcgcttgag
cagagccaggcggcggcggccgtgggccagatccggctcgcccgcgcctatgaggaggtg
ctggccccgcacggcatcaccaccgcgcaggtgctggtcacgctcgaggataccgaggac
cggcggcgctacctcaattcccgcgccacgatggagacgctgctcgggctcggcaccgtg
cccatcgtgaacgagaacgacacggtcgcgaccgacgagatccgcttcggcgacaacgac
cggctggccgcgcagatcgcggtcacggtgggggcggatcagctcgtgctcctgtccgac
gtggacggcttctactcggccaatcccaaggaagatcccaccgccgagcggttcgatctg
gtcgagacgatcacgcccgcgctcgaggcgatggcgggcgatccggtctcgggcctgtcc
aaggggggcatgaagaccaagatcatggcggccaagaccgccgtcgccggcggctgcgcc
atggcgatcaccgaaggctcggcgatgcggccgctcaaggcgctggaacagggcgccgcg
cgcacctggttcgtggcgcagggcgacccgcaggcggcgcgcaagcgctggatcaatgcg
atgaagccgcgcggcacgatccgggtggatgcgggtgcggtccaggcgctgcaggcgggc
aagtcgctgctgcccgcgggcgtggtggcggtcgagggcaatttcgggcgcggcgatccg
gtcgagatcgcagggccgatgggcgaggtgctggggcgcgggctcacccgctacacggcg
gtcgaggcggtgcagatcgcgggccaccgctcggccgagatcgagggcatcctcggctac
agcggccgggcagccctcatccatcgcgacgatatggtgatctga

DBGET integrated database retrieval system