KEGG   Rhodobacter sphaeroides KD131: RSKD131_3739Help
Entry
RSKD131_3739      CDS       T00844                                 

Definition
Aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSKD131_3739
   00052 Galactose metabolism
    RSKD131_3739
Enzymes [BR:rsk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     RSKD131_3739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:682148..683131
Genome map
AA seq 327 aa AA seqDB search
MTLTRFGTAPDGRAVHRIALAAGDLRLALLDRGAILQDLRLAGIDWPLTAGASDLAAYLG
PLRWFGAIVGPVANRIGGARACIDGRPTRFVPNEGQTLLHSGAAGTHARHWQPVEIEAGR
ALLRLELAAGIDGFPGNRRIEAEFVLDPPATLRLILTAVTDAPTLMNLANHSYWTLDPEP
GIGGQQLQIAAEHWLPVEAGLPTGEIRPVSGAMDFRAGRPLGETEGIDQNFCLASAPRDL
TEVARLTGRSGVRLTLATTAPGLQVYTGREIDSGPFAGHGGRPLRAFDAIAFEPQLWPDA
PSRPDFPPITLVPGETFRQETRFSFSA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcacccgtttcggcactgcccctgacgggcgggccgtccaccgcatcgccctg
gccgcaggcgacctccgcctggccctgctcgaccgaggcgccatcctgcaggacctgcgt
ctggccgggatcgactggccgctcacggcaggcgcgtccgacctcgcggcctatctcgga
cccctccgctggttcggcgcgatcgtcggtccggtcgcgaaccgcatcggcggcgcccgg
gcctgcattgatggtcggccgacccgcttcgtgccgaacgagggccagacgctcctccat
tccggggcggcgggaacccatgcccggcactggcagccggtcgagatcgaggcgggccgc
gcgctcctgcggctcgaactcgcagccggcatcgacggatttcccggaaaccggcggatc
gaggccgagttcgtgctggacccgcccgcgacgctccggctgatcctgaccgcggtcacg
gatgcgccgacgctgatgaacctcgccaaccacagctactggaccctcgatcccgagccc
gggatcggcggccagcagctgcagatcgcggcggagcactggcttccggtcgaggctggc
ctgcctacgggcgagatccgccccgtatccggagcgatggacttccgcgcgggccgcccc
ctcggagagaccgaggggatcgaccaaaatttctgcctcgccagtgcgccgcgagacctg
accgaggtggcgcgcctcaccggccggtcgggcgtccgtctcacccttgccaccacggcc
ccgggcctgcaggtctataccggccgcgagatcgacagcgggcccttcgcgggccacggg
ggccgaccgctccgggccttcgacgccattgcgttcgagccgcagctctggccggacgcg
ccgagccggccggatttccccccgatcacccttgtcccgggcgagaccttccgccaggag
acgcgcttctccttctccgcctga

DBGET integrated database retrieval system