KEGG   Rhodobacter sphaeroides KD131: RSKD131_3756Help
Entry
RSKD131_3756      CDS       T00844                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RSKD131_3756
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSKD131_3756
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RSKD131_3756
Enzymes [BR:rsk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RSKD131_3756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(693499..694737)
Genome map
AA seq 412 aa AA seqDB search
MRAMAEDGINSYMTGPDEQGRFGIFGGRFVSETLMPLILDLEARYEHAKTDPDFWAEMDD
LWKNYVGRPSPLYFAPRLTEHLGGAKIYLKRDELNHTGAHKINNVLGQIILARRMGKTRI
IAETGAGQHGVATATVCAKFGLKCVVYMGAHDVERQAPNVFRMRLLGAEVVPVTSGRGTL
KDAMNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQSIIGREVRWQLAEQEEGRLPD
TLVAAIGGGSNAMGLFYPFLDDPSVRIVGVEAGGKGVDDRMEHCASLTGGRPGVLHGNRT
YLLQDADGQILEGFSISAGLDYPGIGPEHAWLHDTGRAEYVSITDAEALEAFQLCCALEG
IIPALEPSHALAHVIKIAPTLPRDHIIVMNMCGRGDKDIFTVAKHLGFDMKL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgccatggccgaggacggcatcaacagctacatgaccggccccgacgagcagggt
cgtttcggcatcttcggcggacgcttcgtgtccgagacgctgatgccgctgattctcgat
ctcgaagcgcgctatgaacatgccaagaccgacccggatttctgggccgagatggacgac
ctgtggaagaactacgtcggtcgtccctcgccgctctatttcgcgccgcggctgaccgag
catctcggcggggcgaagatctatctcaagcgcgacgagctgaaccataccggcgcgcac
aagatcaacaatgtgctgggccagatcatcctcgcccgccgcatgggcaagacccggatc
atcgccgagacgggcgcgggccagcatggcgtggcgacggcgacggtctgcgccaagttc
gggctgaaatgcgtggtctacatgggcgcgcacgatgtcgagcggcaggcgccgaacgtg
ttccgcatgcggctgctgggcgccgaggtggtgccggtgacctccgggcgcggcacgttg
aaggatgcgatgaacgacgccctgcgcgactgggtcaccaacgtgcgcgacaccttctac
tgcatcggcaccgtggcgggcccgcatccctatccggcgatggtgcgcgacttccagtcg
atcatcggccgcgaagtgcgctggcagctggccgagcaggaggagggccgcctgcccgac
acgctcgtggccgccatcggcggcgggtcgaacgccatggggctcttctacccgttcctc
gacgatccgtcggtgcggatcgtcggcgtcgaggccgggggcaagggcgtcgacgaccgg
atggaacattgtgcctcgctgaccggcggacgtccgggcgtgctgcacggcaaccggacc
tatctgctgcaggatgcggacggccagatcctcgaggggttctcgatctcagccgggctc
gactatccgggcatcgggcccgaacatgcatggctccatgacacgggccgggcggagtat
gtctcgatcaccgatgccgaagcgctggaggcgttccagctctgctgtgcgctcgagggg
atcattcccgcgctcgagccgtcgcacgcgctggcccatgtcatcaagatcgcgccgacg
ctgccgcgcgaccatatcatcgtgatgaacatgtgcgggcggggcgacaaggacatcttc
acggtggcgaagcatctgggcttcgacatgaagctctga

DBGET integrated database retrieval system