KEGG   Rhodobacter sphaeroides KD131: RSKD131_3772Help
Entry
RSKD131_3772      CDS       T00844                                 

Definition
Lipolytic enzyme, G-D-S-L family precursor
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RSKD131_3772
Enzymes [BR:rsk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RSKD131_3772
   3.1.2  Thioester hydrolases
    3.1.2.-  
     RSKD131_3772
Lipid biosynthesis proteins [BR:rsk01004]
 Fatty acid synthase
  Component type
   RSKD131_3772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(709435..710070)
Genome map
AA seq 211 aa AA seqDB search
MRNMALALVFSAMPAAAAEEVTVLALGDSLTAGYGLPEGEGFVPQMQQWLRDHGESVALV
NAGVSGDTTAGGRARLDWSLTPEVDAMIVNLGGNDMLRGLDPALTRGNLEAILKAAEERD
LPVLLVGLAAPGNYGPDFKRSFDAIFPGLAQSYGADLEPNFFAALAARLDEPDARQRYMQ
PDGIHPSAEGVAVIVEEMGPRVQALVERARQ
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacatggcgctggccctcgtcttctcggccatgcctgcggccgcggccgaggag
gtcacggtgctcgcgctcggcgacagcctgacggcgggctacggcctgcccgagggcgag
ggcttcgtgccgcaaatgcagcaatggctgcgggaccatggcgagagcgtcgcgctggtg
aatgccggcgtctcgggcgacacgacggcgggcggccgcgcgcggctcgactggagcctg
acgcccgaggtcgatgccatgatcgtgaacctcggcggcaatgacatgctgcgcggcctc
gatccggcgctgacgcgcgggaacctcgaggcgatcctgaaggcggccgaggagcgcgac
ctgccggtgcttctggtcgggctcgcggcgccgggcaattacggccccgacttcaagcgg
tcgttcgatgcgatctttccaggtctggcccaaagctacggcgcggatctggaaccgaac
ttcttcgccgcccttgccgcacggctggacgagcccgacgcgcggcagcgctacatgcag
cccgacggcatccatccgagcgccgagggcgtggccgtgatcgtggaggaaatggggccg
cgcgtgcaggcgctggtcgagcgcgcgcggcagtag

DBGET integrated database retrieval system