KEGG   Rhodobacter sphaeroides KD131: RSKD131_3772Help
Entry
RSKD131_3772      CDS       T00844                                 

Definition
Lipolytic enzyme, G-D-S-L family precursor
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rsk01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(709435..710070)
Genome map
AA seq 211 aa AA seqDB search
MRNMALALVFSAMPAAAAEEVTVLALGDSLTAGYGLPEGEGFVPQMQQWLRDHGESVALV
NAGVSGDTTAGGRARLDWSLTPEVDAMIVNLGGNDMLRGLDPALTRGNLEAILKAAEERD
LPVLLVGLAAPGNYGPDFKRSFDAIFPGLAQSYGADLEPNFFAALAARLDEPDARQRYMQ
PDGIHPSAEGVAVIVEEMGPRVQALVERARQ
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacatggcgctggccctcgtcttctcggccatgcctgcggccgcggccgaggag
gtcacggtgctcgcgctcggcgacagcctgacggcgggctacggcctgcccgagggcgag
ggcttcgtgccgcaaatgcagcaatggctgcgggaccatggcgagagcgtcgcgctggtg
aatgccggcgtctcgggcgacacgacggcgggcggccgcgcgcggctcgactggagcctg
acgcccgaggtcgatgccatgatcgtgaacctcggcggcaatgacatgctgcgcggcctc
gatccggcgctgacgcgcgggaacctcgaggcgatcctgaaggcggccgaggagcgcgac
ctgccggtgcttctggtcgggctcgcggcgccgggcaattacggccccgacttcaagcgg
tcgttcgatgcgatctttccaggtctggcccaaagctacggcgcggatctggaaccgaac
ttcttcgccgcccttgccgcacggctggacgagcccgacgcgcggcagcgctacatgcag
cccgacggcatccatccgagcgccgagggcgtggccgtgatcgtggaggaaatggggccg
cgcgtgcaggcgctggtcgagcgcgcgcggcagtag

DBGET integrated database retrieval system