KEGG   Rhodobacter sphaeroides KD131: RSKD131_3974Help
Entry
RSKD131_3974      CDS       T00844                                 

Definition
Deoxyribose-phosphate aldolase
Orthology
K01619  
deoxyribose-phosphate aldolase [EC:4.1.2.4]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RSKD131_3974
Enzymes [BR:rsk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.4  deoxyribose-phosphate aldolase
     RSKD131_3974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:919432..920406
Genome map
AA seq 324 aa AA seqDB search
MKAPAMPDSHPRNPGTPFAPDWFEEMQVNRTAAERRAATISGSRSVKKDHQAAWLLRAIQ
CIDLTTLSGDDTPGKVRRLCAKARQPVRPDLLEAMGVGDIGLTTGAVCVYPTMVPHAVAA
LQGSGIPVASVATGFPAGLTPLSQRLAEITYAVEAGASEIDIVITREHVLLGNWQALYDE
VAAMRAACGEAHMKAILATGELGTLTNVYRASMVAMQAGSDFIKTSTGKETENATLPVSL
TMLRALRDYGERTGYRIGFKPAGGLRAAKDALAWLALMKEELGQPWLRPDLFRIGASTLL
GDIERQLEHHVTGRYASADHHALS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcccccgccatgcccgacagccacccccgcaaccccggcacgcccttcgccccc
gactggttcgaggagatgcaggtgaaccgcaccgcggccgagcgccgcgcggccacgatc
tcgggcagccgctcggtcaagaaggatcatcaggccgcctggctcctgcgcgcgatccag
tgcatcgacctgaccaccctgtcgggcgacgacacgccgggcaaggtgcgccggctctgc
gccaaggcgcgccagcccgtgcggccggacctcttggaggcgatgggcgtgggcgacatc
ggcctgaccacgggggcagtctgcgtctatccgacgatggtgccccatgcggtcgcggcc
cttcagggctcgggcattccggtggcctcggtcgccacgggctttcccgccggcctgacg
ccgctgtcgcagcggctggccgagattacctatgccgtcgaggcgggcgcctccgagatc
gacatcgtcatcacccgcgagcatgtgctgctgggcaactggcaggcgctctacgacgag
gtcgcggccatgcgggccgcctgcggcgaggcgcacatgaaggcgatcctcgccacgggc
gagctcggcacgctgacgaacgtctaccgcgcctcgatggtcgcgatgcaggcggggtcc
gacttcatcaagacctcgaccggcaaggagaccgagaacgccaccctgcccgtctcgctc
accatgctgcgggcgctgagggactatggcgagcggacgggctatcggatcggcttcaag
cccgccgggggcctgcgcgcggccaaggacgcgctggcctggctcgcgctgatgaaggag
gagctgggccagccgtggctcaggcccgacctcttccgcatcggcgcctcgacgctgctc
ggcgacatcgagcggcaactcgagcaccacgtcacggggcgctatgccagcgccgaccac
cacgccctgagctga

DBGET integrated database retrieval system