KEGG   Rhodobacter sphaeroides KD131: RSKD131_4445Help
Entry
RSKD131_4445      CDS       T00844                                 

Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    RSKD131_4445
Enzymes [BR:rsk01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     RSKD131_4445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRSKD131A:136337..138271
Genome map
AA seq 644 aa AA seqDB search
MSDKERGGISRRGLLGATAGGAALGALGPRAAMLAGGAGLATAAATGPAAADSKFALAPG
ELDEYYGFWSSGQTGELRILGIPSMRELMRVPVFNRCSATGWGQTNESLRIMTENMSDKT
RAFLQANGKKVHDNGDLHHVHMSFTEGKYDGRFLFMNDKANTRVARVRCDVMKTDAILEI
PNAKGIHGLRPQKWPRTNYVFANGEDEAPMVNDGKVLDDPSQYVNFFTAVDADKMKVAWQ
VLVSGNLDNTDADYEGKYAFSTSYNSEMGTNLGEMMAAEMDHVVVFNIPEIEKGIAAGDF
QELNGVKVIDGRKGQNKNYTRYIPVANNPHGCNMAPDKIHLCINGKLSPTVTVIDVRKLD
AVFYEGAEPRSTVVAEPELGLGPLHTAFDGAGNCYTSLFLDSQVVKWNIDKAIRAYNGEK
VDPILQKLDVQYQPGHLKTSMGETLEADGKWLVALCKFSKDRFLNVGPLKPENDQLIDIS
GDKMVLVHDGPTFAEPHDAIAVHAAKMNIRSVWDRNDPMWAETRKQAEADGVDIDDFSGE
VIRDGNKVRVYLSGVAPSYSLEKFTVTEGDEVTVIVTNLDDVDDLTHGFTMGNHGVAMEI
GPQATSSVTFVAAQPGVYWYYCQWFCHALHMEMRGRMFVEPKAA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaggaacggggaggcatcagccggcgcggcctgctcggcgcgacggccgga
ggcgcggcgctgggggcgctcggtccccgcgcggcgatgctggccggaggggcggggctt
gccaccgccgcggccaccggacccgcggcggcggactcgaagttcgcgctcgcgccgggc
gaactcgacgaatattacggcttctggtcctcgggccagaccggcgagctgcgcatcctc
ggcatcccgtcgatgcgcgagctgatgcgggtgccggtcttcaaccgctgctccgccacg
ggctggggccagaccaacgagtcgctgcggatcatgaccgagaacatgtccgacaagacg
cgggccttccttcaggccaacggcaagaaggtccacgacaatggcgacctccaccacgtc
cacatgtccttcaccgagggcaagtatgacggccgcttcctcttcatgaacgacaaggcc
aacacgcgcgtggcgcgggtgcgctgcgacgtgatgaagaccgatgcgatcctcgagatc
ccgaacgctaagggcatccacggcctgcgcccgcagaaatggccgcgcaccaactatgtc
ttcgccaacggcgaggacgaggcgccgatggtcaatgacggcaaggtgctcgacgatccg
tcgcaatatgtgaacttcttcacggcggtcgatgcggacaagatgaaggtcgcctggcag
gtgctggtctcgggcaacctcgacaacaccgatgccgactacgagggcaaatatgccttc
tcgacctcctacaactccgagatgggcaccaacctcggcgagatgatggcggcggagatg
gaccatgtggtcgtcttcaacattcccgagatcgagaaggggattgccgcgggcgacttc
caggagctgaacggcgtcaaggtgatcgacggccgcaagggccagaacaagaactatacc
cgctacatcccggtcgcgaacaacccgcacggctgcaacatggcgccggacaagatccac
ctctgcatcaacggcaagctctcgcccacggtgacggtgatcgacgtgcgcaagctcgac
gcggtgttctatgagggcgccgagccgcgctcgaccgtggtggccgagccggaactgggc
ctcgggccgctgcacaccgccttcgacggcgcgggcaactgctacacctcgctgttcctc
gacagccaggtggtcaagtggaacatcgacaaggcgatccgggcctacaacggcgagaag
gtcgatccgatcctgcagaagctcgacgtgcagtatcagccgggccacctgaagacctcg
atgggcgagacgctcgaggcggacggcaagtggctggtggcgctctgcaaattctccaag
gaccggttcttgaacgtgggcccgctcaagcccgagaacgaccagctgatcgacatttcg
ggcgacaagatggtgctggtccacgacggcccgaccttcgccgagccccatgacgccatc
gccgtccatgccgcgaagatgaacatccgctcggtctgggaccgcaacgacccgatgtgg
gccgagacgcgcaaacaggccgaggccgacggggtcgacatcgacgacttctccggcgag
gtgatccgcgacggcaacaaggtccgcgtctatctctcgggcgtggcgccgtcctatagc
ctcgagaagttcaccgtgaccgagggcgacgaggtgacggtgatcgtgaccaacctcgac
gatgtggacgacctgacccacggcttcaccatgggcaaccacggcgtcgcgatggagatt
gggccgcaggcgacctcctctgtcaccttcgtggcggcgcagccgggcgtctactggtac
tactgccagtggttctgccacgcgctccatatggagatgcgcggccggatgttcgtcgag
ccgaaggcggcctga

DBGET integrated database retrieval system