KEGG   Ralstonia solanacearum PSI07: RPSI07_0136Help
Entry
RPSI07_0136       CDS       T01273                                 

Definition
methyl-accepting chemotaxis protein
Orthology
K03406  
methyl-accepting chemotaxis protein
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPSI07_0136
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RPSI07_0136
Bacterial motility proteins [BR:rsl02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    RPSI07_0136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
141700..143499
Genome map
AA seq 599 aa AA seqDB search
MSSLRTRILVISSATVIGALALSGAATYAIVRASTMESIDQNLTAIASGNTLAIDKWVTA
KAQAVKATAEVVEHGDPRGLVKHMGDADGFPITTIGWTDKTFFSTSAGTPKDYDPTARPW
YKSAVAAGKLTVTKPYGDASTGVPYVSFAAPLMRNGEATGALSGAVPLDGVREVVAAVHP
TPSSLAFVVARDGQVIAHPDAKLMLKPVTDVSAALTPDALTALAKATAPLEVELAGAAKL
LKAQAVQGTDWYLVIALDKAEATAGLRSVARALGVAMVLLTLAAVGIAAFFTAQSFRRLS
QVRDAMDTIGSGGGDLTHRLPVVGSDEVAQISASFNTFIDKIGEVLLEVRASVENMKSAT
GEIEMGNRDLSLRTETSASNLQETSAALTELTTSVKNSAEAAVQATHLAGAASEAAVRGG
EVVSGAVGTMAAIAQSSSRISEIIGVIDSIAFQTNILALNAAVEAARAGENGRGFAVVAG
EVRTLAQRSAAAAREIKELIQASEASVKAGAERVNAAGTTMHEIVEGIERVSRIIGEIDG
AMHEQSAGISQIDRSVAEMDQATQQNAALVEQSTAASSMLNEQAHGLARTVGLFRLRGA
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctctccgcacccgcatcctcgtcatctcttcggccaccgtgatcggtgcgctt
gcgctgtcgggggccgccacgtatgccatcgtgcgcgccagcacgatggaatccatcgac
cagaacctgacggccatcgccagcggcaacacgctggccatcgacaagtgggtgacggcc
aaggcccaggccgtgaaggctacggcggaggtggtggaacatggcgatccgcgtggcctg
gtcaagcacatgggggatgccgacggcttcccgatcaccaccatcggctggaccgacaag
acgttcttctccaccagcgccggcacgcccaaggattacgatccgaccgcccgcccctgg
tacaagtcggccgtcgccgccggcaagctgaccgtcaccaagccctacggcgatgcgtcg
accggcgtgccgtacgtatccttcgccgcgccgctgatgcgcaatggcgaggcgaccggc
gcgctgagcggcgcggtgcccctggatggcgtgcgcgaagtggtggcggcggtgcatccg
acgccgtcgagcctggccttcgtggtggcgcgcgatggccaggtgatcgcgcatccggac
gccaagctgatgctcaagcccgtgacggacgtgtcggccgcgctgacgccggatgcgctg
acggcgctggccaaggcgaccgcgccgctggaggtggagctggccggtgccgccaagctg
ctcaaggcgcaggcggtgcagggcaccgactggtatctggtgatcgcgctggacaaggcc
gaggccaccgccggcctgcgcagcgtggcgcgcgcactgggcgtggcgatggtgctgctg
acgctggcggcggtgggcatcgcggcgttcttcaccgcgcagtcgttccgccggctgtcg
caggtgcgcgatgcgatggacaccatcggctccggcggcggcgacctgacgcatcgtctg
ccggtggtcggcagcgatgaggtggcgcagatctccgcatcgttcaacaccttcatcgac
aagatcggcgaggtgctgctggaggtgcgcgccagcgtcgaaaacatgaagtccgccacc
ggcgagatcgagatgggcaaccgcgacctgtcgcttcgcacggagacctcggcgagcaat
ctgcaggaaacgtcggccgcgctcaccgagctcaccaccagcgtgaaaaactccgccgaa
gccgccgtgcaagccacgcacctcgcgggtgcggccagcgaggcggccgtgcgcggcggc
gaggtggtgtcgggcgcggtcggcacgatggccgcgatcgcgcagtcgtcgtcgcgcatc
agcgagatcatcggcgtgatcgacagcatcgccttccagaccaacatcctcgcgctcaat
gccgcggtggaggccgcccgcgccggcgagaacggccgcggctttgccgtggtggccggc
gaggtgcgcacgctggcgcagcgcagcgccgccgccgcgcgcgagatcaaggagctcatc
caggcgtcggaagccagcgtcaaggccggcgccgagcgggtcaacgccgccggcacgacg
atgcacgagatcgtggaaggcatcgagcgcgtcagccgcatcatcggcgagatcgacggt
gccatgcacgagcagagcgcgggcatcagccagatcgaccgcagcgtcgccgagatggat
caggccacgcagcagaacgccgcgctggtggagcagtcgaccgccgcctcgtcgatgctc
aacgagcaggcgcatgggctggcgcggacggtggggttgttcaggctgcgcggggcttag

DBGET integrated database retrieval system