KEGG   Ralstonia solanacearum PSI07: RPSI07_0267Help
Entry
RPSI07_0267       CDS       T01273                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rsl  Ralstonia solanacearum PSI07
Brite
Enzymes [BR:rsl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     RPSI07_0267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
260978..261439
Genome map
AA seq 153 aa AA seqDB search
MIVVPRAAFEIAKHFEGFHRVPKADPLRAHPYVCPAGYWTIGYGHLCDPTHPPITQAQAE
VYLAADLVTALNATLRYCPVLAVEPEGRLAAIIDFTFNLGAGRLQTSTLRRRINQRDWAA
VANELRRWVYGGDKVLPGLAARREAEVALLRLN
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
gtgattgtggtgccccgagcggccttcgaaatcgccaagcacttcgaggggttccatcgg
gtgccgaaggccgacccgctgcgggctcatccgtatgtctgccccgctgggtactggacg
atcggctacggtcacctctgcgatccgacgcacccgcccatcacgcaggcccaggccgaa
gtctatctggcggcggatctcgtgacagcgctcaacgcgacgctgcgctactgccccgtg
cttgccgtcgagccagagggcaggctcgcagccatcatcgacttcaccttcaacctcggg
gcggggcggctgcagacctcgactttgcggcgacgcatcaatcagcgggattgggctgct
gtcgcaaacgagctgcgccgctgggtctacggtggcgacaaggtgctgccggggctggcc
gcgcgtcgcgaagccgaagtggctttattgcgattgaactga

DBGET integrated database retrieval system