KEGG   Ralstonia solanacearum PSI07: RPSI07_0355Help
Entry
RPSI07_0355       CDS       T01273                                 

Gene name
adhA
Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00010  Glycolysis / Gluconeogenesis
rsl00071  Fatty acid degradation
rsl00350  Tyrosine metabolism
rsl00625  Chloroalkane and chloroalkene degradation
rsl00626  Naphthalene degradation
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
rsl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPSI07_0355 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    RPSI07_0355 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    RPSI07_0355 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPSI07_0355 (adhA)
   00626 Naphthalene degradation
    RPSI07_0355 (adhA)
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RPSI07_0355 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C adh_short TrkA_N NAD_binding_10 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CBJ49728
UniProt: D8NVZ5
Position
complement(343430..344455)
Genome map
AA seq 341 aa AA seqDB search
MAQSMKAAVVHAFGEPLRIEEVPIPTPGRGQILVNIRASGVCHTDLHAADGDWPVKPSLP
FIPGHEGVGFVAAVGEGVTAVKEGDRVGVPWLYTACGHCEHCLSGWETLCHDQQNTGYSV
NGGYAEYVLADPNYVGHLPAQVGFEEIAPILCAGVTVYKGIRMTDTRPGQWIAISGIGGL
GHVAVQYAIAMGLHVVAVDVAPEKLALARELGARLTVDASQQDPAAVIQKALGGVHGVLV
TAVSRSAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
QFAAEGQVRARIHRDRLDNINQVFADLKAGKVDGRIVLSLD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtcgatgaaagccgctgtcgtgcacgcgttcggagaaccgctgcgcatcgag
gaagtccccatcccgacgccgggccgcggacagatcctcgtcaacatccgggcctccggg
gtctgccacaccgacctgcacgccgccgacggcgactggccggtcaagcccagcctgccg
ttcatcccgggacatgaaggcgtgggcttcgtggcggcagtgggcgaaggcgtcaccgcc
gtcaaggaaggcgaccgcgtgggcgtgccctggctctacaccgcctgcggccactgcgag
cattgcctcagcggctgggaaaccctgtgccacgatcagcagaacaccggctactccgtc
aacggcggctatgccgaatacgtgctggccgacccgaactatgtcggccacctgccggcg
caggtcggcttcgaggagatcgcgcccatcctgtgcgcgggcgtgacggtctacaagggc
atccgcatgaccgacacgcggcccggccagtggatcgccatctcgggcatcggcgggctg
gggcatgtggcggtgcaatacgccatcgccatggggctgcacgtggtggcggtggatgtc
gcccccgagaagctggcgctggcgcgcgaactgggcgccaggctgaccgtcgatgcctcg
cagcaggacccggccgccgtcatccagaaggcgctgggcggcgtgcacggcgtgctggtg
acggcggtctcgcgcagcgccttcgcccaggccctgggcatggttcggcgcggcggcacc
gtctcgctcaacgggctgccgccgggcgactttccgctgccgatcttctcgaccgtgctc
aacggcatcacggtgcgcggctccatcgtcggcacgcggcgcgacctgcaggagtcgctg
cagtttgccgccgaggggcaggtgcgcgcccgcatccaccgcgaccggctcgacaacatc
aaccaggtcttcgccgacctcaaggccggcaaggtggacggccgcatcgtcctttcgctg
gactga

DBGET integrated database retrieval system