KEGG   Ralstonia solanacearum PSI07: RPSI07_0355Help
Entry
RPSI07_0355       CDS       T01273                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RPSI07_0355 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPSI07_0355 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    RPSI07_0355 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    RPSI07_0355 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RPSI07_0355 (adhA)
   00626 Naphthalene degradation
    RPSI07_0355 (adhA)
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RPSI07_0355 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(343430..344455)
Genome map
AA seq 341 aa AA seqDB search
MAQSMKAAVVHAFGEPLRIEEVPIPTPGRGQILVNIRASGVCHTDLHAADGDWPVKPSLP
FIPGHEGVGFVAAVGEGVTAVKEGDRVGVPWLYTACGHCEHCLSGWETLCHDQQNTGYSV
NGGYAEYVLADPNYVGHLPAQVGFEEIAPILCAGVTVYKGIRMTDTRPGQWIAISGIGGL
GHVAVQYAIAMGLHVVAVDVAPEKLALARELGARLTVDASQQDPAAVIQKALGGVHGVLV
TAVSRSAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
QFAAEGQVRARIHRDRLDNINQVFADLKAGKVDGRIVLSLD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtcgatgaaagccgctgtcgtgcacgcgttcggagaaccgctgcgcatcgag
gaagtccccatcccgacgccgggccgcggacagatcctcgtcaacatccgggcctccggg
gtctgccacaccgacctgcacgccgccgacggcgactggccggtcaagcccagcctgccg
ttcatcccgggacatgaaggcgtgggcttcgtggcggcagtgggcgaaggcgtcaccgcc
gtcaaggaaggcgaccgcgtgggcgtgccctggctctacaccgcctgcggccactgcgag
cattgcctcagcggctgggaaaccctgtgccacgatcagcagaacaccggctactccgtc
aacggcggctatgccgaatacgtgctggccgacccgaactatgtcggccacctgccggcg
caggtcggcttcgaggagatcgcgcccatcctgtgcgcgggcgtgacggtctacaagggc
atccgcatgaccgacacgcggcccggccagtggatcgccatctcgggcatcggcgggctg
gggcatgtggcggtgcaatacgccatcgccatggggctgcacgtggtggcggtggatgtc
gcccccgagaagctggcgctggcgcgcgaactgggcgccaggctgaccgtcgatgcctcg
cagcaggacccggccgccgtcatccagaaggcgctgggcggcgtgcacggcgtgctggtg
acggcggtctcgcgcagcgccttcgcccaggccctgggcatggttcggcgcggcggcacc
gtctcgctcaacgggctgccgccgggcgactttccgctgccgatcttctcgaccgtgctc
aacggcatcacggtgcgcggctccatcgtcggcacgcggcgcgacctgcaggagtcgctg
cagtttgccgccgaggggcaggtgcgcgcccgcatccaccgcgaccggctcgacaacatc
aaccaggtcttcgccgacctcaaggccggcaaggtggacggccgcatcgtcctttcgctg
gactga

DBGET integrated database retrieval system