KEGG   Ralstonia solanacearum PSI07: RPSI07_0545Help
Entry
RPSI07_0545       CDS       T01273                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rsl00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:rsl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
535692..537047
Genome map
AA seq 451 aa AA seqDB search
MAELDPTPAAADTDSDLALAERPVRRDVSLMDKLLIEGNGPLSGEIRVSGAKNAALPIMC
AALLTPEPLTLHNVPNLQDVRTMLKLLRQMGVAGTQNGHDVTLDAADIHTPEASYDLVKT
MRASILVLGPLLARFGHARVSLPGGCGIGARPVDQHIKGLQQMGAEIVIEHGYIEAKLAD
GAKRLRGARIVTDMVTVTGTENLLMAAVLADGETVLENAAREPEVTDLANLLVKMGARID
GIGTDRLVVQGVEALKGAEHTVIADRIEAGTFLCAVAAAGGDVTLRGVPPGILDAVLDKL
REAGLTLTTGDDWIRAQMHGRPKAVSFRTSEYPAFPTDMQAQFMMLNCIAEGSALVTETI
FENRFMHVQELNRLGANIVTEGNTAAVTGVEQLSGATVMATDLRASASLVIAGLVAQGET
LVDRIYHLDRGYDRIEDKLSAVGAKIRRIQG
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggctgagctcgatcccactccggctgccgccgataccgattccgaccttgcgctcgcc
gagcgccccgtacgacgtgatgtctcgctcatggacaaactgctgatcgaaggcaatggc
ccgctgtcgggcgaaatccgcgtttccggtgccaagaatgccgcgctgccgatcatgtgc
gccgcgctgctgacgcccgagccgctcacgctgcacaacgtgcccaatctgcaggatgtg
cgcaccatgctcaagctgctgcgccagatgggcgtggcgggcacgcagaacggtcatgac
gtcacgctcgatgccgccgatatccacacgccggaagcgtcgtacgacctggtgaagacc
atgcgtgcgtcgatcctcgtgctggggccgctgctggcgcgcttcggccatgcgcgcgtg
tcgttgccgggcggctgcggcatcggcgcgcggccggtcgaccagcacatcaagggcctg
cagcagatgggcgccgagatcgtcatcgagcacggctacatcgaagcgaagctcgccgac
ggcgccaagcggctgcgcggcgcgcgcatcgtcaccgacatggtgaccgtgaccggcacc
gagaacctgctgatggccgccgtgctggccgacggcgagaccgtgctggaaaacgccgcg
cgcgagccggaagtgaccgacctcgccaacctcctggtgaagatgggcgcgcgtatcgac
ggcatcggcaccgaccgcctggtggtgcagggcgtcgaagcgctcaagggtgccgagcac
accgtcatcgccgaccgcatcgaggccggcacgttcctgtgcgcggtggctgcggctggc
ggcgatgtgacgttgcgcggcgtgccgccgggcattctcgacgcggtgctcgacaagctg
cgcgaagccggcctgacgctcaccacgggcgacgactggattcgcgcgcagatgcacggc
cgcccgaaggcggtcagcttccgcacctcggaatacccggctttcccgaccgacatgcag
gcgcagttcatgatgctgaactgcattgccgaagggtccgcgctggtgacggagacgatc
ttcgagaaccgtttcatgcacgtgcaggaactgaaccgcctgggcgccaacatcgtcacc
gaaggcaacacggcagcggtgacgggcgtggagcagctctcgggcgcgaccgtgatggcg
accgacctgcgcgcctcggccagcttggtgatcgccggcctggtggcacagggcgaaacg
ctggtcgaccgcatctatcacctggatcgcggctacgaccgcatcgaggacaagctgtcg
gcggtgggcgcgaagatccgccgcatccaaggttaa

DBGET integrated database retrieval system