KEGG   Ralstonia solanacearum PSI07: RPSI07_0547Help
Entry
RPSI07_0547       CDS       T01273                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rsl01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:rsl00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
537764..539092
Genome map
AA seq 442 aa AA seqDB search
MSLIIRKLDSADAGFAAQLRQVLAFEASEDEAIDRAAAQILADVKARGDAAVLETTQRFD
RIEAESVAALELSPAVLQAALDGLEPKRRAALEAAAARVRAYHEKQKIECGTHSWEYAEA
DGTVLGQKITPLDRVGIYVPGGKAAYPSSVLMNAIPARVAGVKEIIMVVPTPGGVRNELV
LAAACIAGVDRVFTIGGAQAVGALAYGTETVPAVDKIVGPGNAYVAAAKRRVFGTVGIDM
IAGPSEILVICDGTTDPDWVAMDLFSQAEHDELAQSILLCPDAGFIAQVEASIQRQLEDM
PRKEVIAASLSGRGALIQVRDMDEACEITNDIAPEHLEISAENPRQWAERIRHAGAIFLG
KYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFIKRSSLIEVSEAGAQMLGEIASELA
YGEGLQAHARSAEYRLQRTTTE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgatcatccgcaaactggattcggccgacgccggattcgcggcgcaactgcgc
caggtgctcgccttcgaggcgagcgaagacgaagccatcgaccgcgccgccgcgcagatc
ctggccgacgtgaaggcgcgcggcgacgccgccgtgctggagaccacgcaacgcttcgac
cgcatcgaagcggagagcgtggccgcgctggagctgtcgccggccgtgctgcaggccgcg
ttggatggcttggagcccaagcgccgcgccgcgctggaggcggccgccgcccgcgtgcgc
gcctaccacgagaagcagaagatcgagtgcggcacgcacagttgggagtacgcggaagcc
gacggcaccgtgctcggccagaagatcacgccgctcgatcgcgtcggcatctacgtgccg
ggcggcaaggcggcgtatccgtcgtcggtgctgatgaatgcgattccggcacgcgtggcc
ggcgtcaaggaaatcatcatggtggtgcccacgccgggtggcgtgcgcaacgagctggtg
ctggccgcggcctgcatcgccggggtggaccgcgtgttcaccatcggcggcgcgcaggcg
gtgggggcgctggcctacggcaccgagaccgtgccggcggtcgacaagatcgtcggcccg
ggcaacgcctacgtggcggcggccaagcggcgcgtgttcggcacggtcggcatcgacatg
atcgccgggccgtccgagatcctcgtcatctgcgacggcaccaccgatccggactgggtg
gcgatggacctgttctcgcaggccgagcacgacgaactcgcacagtcgatcctgctgtgc
ccggacgccggcttcatcgcccaggtggaggccagcatccagcgccagctcgaagacatg
ccgcgcaaggaggtgattgccgcctcgctgtcggggcgcggtgcgctgatccaggtacgc
gacatggacgaggcgtgcgagatcaccaacgatatcgcgccggagcatctggagatctcc
gccgagaacccgcgccagtgggccgagcgcatccgccatgccggcgccatcttcctcggc
aagtacaccagcgagtcgctgggcgactactgcgcgggcccgaaccacgtgctgccgacc
tcgcgcacggcgcgcttctcgtcgccgctgggcgtgtacgacttcatcaagcgctcgagc
ctcatcgaagtgagcgaggcgggcgcgcagatgctgggcgagatcgcctccgagctggcc
tatggcgagggtttgcaggcgcatgcccgcagcgccgaataccgcctgcaacgcacgacc
accgagtga

DBGET integrated database retrieval system