KEGG   Ralstonia solanacearum PSI07: RPSI07_0610Help
Entry
RPSI07_0610       CDS       T01273                                 

Definition
thiol:disulfide interchange protein (DsbC-like)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
rsl  Ralstonia solanacearum PSI07
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
599841..600587
Genome map
AA seq 248 aa AA seqDB search
MSFRIRVAAIASAVLVAAMGAGYALTAGAAEPALDKVKASVQKALGPNVEIKGVAKSPLP
GLYEVNLGSQVVYMDATGRYVLNGDLLDTQTATNLTQERMAEINRIKWSDLPLDRAVKWV
KGNGARKIAVFSDPNCPYCHKLEQMFSQVDNITVYTFLLPILSEDSSTKAKQIWCSADRA
KAWRDWMVSKNAPAGAGNCETPLEDNLKLGRALNVNGTPAIIFMDGSRAPGLIDAATLER
KFASLKKS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttcgtattcgggtggcggccatcgcctcggcggtgctggtcgccgccatgggc
gcgggttacgcgctgacggccggtgccgccgagcccgcgctggacaaggtcaaggcatcg
gtgcagaaggcgctggggccgaacgtcgagatcaagggcgtggccaagtcgccgctgccg
gggctgtacgaggtgaatctcggcagccaggttgtctacatggatgccaccggccgctat
gtgctcaacggcgacctgctcgatacgcagaccgccaccaacctcacgcaggagcgcatg
gccgagattaaccgcatcaaatggtccgacctgccgctggaccgcgcggtgaagtgggtc
aagggcaatggcgcgcgcaagatcgccgtgttctccgacccgaactgcccgtactgccac
aagctggagcagatgttctcgcaggtcgacaacatcacggtctacaccttcctgctcccg
atcctgtccgaggattccagcaccaaggccaagcagatctggtgctcggccgaccgcgcc
aaggcctggcgtgactggatggtgtccaagaacgccccggccggcgccggcaattgcgag
acgccgctggaggacaacctgaagctggggcgagcgctcaacgtcaacggcaccccggcc
atcatcttcatggacggctcgcgggcaccgggcctgatcgatgcggccacgctggaacgc
aagttcgcgtcgctgaagaagtcgtga

DBGET integrated database retrieval system