KEGG   Ralstonia solanacearum PSI07: RPSI07_0619Help
Entry
RPSI07_0619       CDS       T01273                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rsl01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:rsl00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(608450..609253)
Genome map
AA seq 267 aa AA seqDB search
MSDILQKILAVKAEEVAAARKHRDLPSVRTEAEANRHDSALGPRGFAQAMRDKIGAGQAA
VIAEVKKASPSKGVLRPDFKPAEIAGSYAEHGAACLSVLTDEQFFQGHADYLREARAACA
LPVLRKDFMVDLYQVYEARSWGADCILLIVAALDQGLMVELEACAHELGMDVLVEVHDGH
ELERALRLSTPLVGVNNRNLRTFETTLDTTLGLLKHMPGDRVVVTESGILKPDDVHKMRA
ADVNAFLVGEAFMRADDPGAELARLFT
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcctgcagaagatcctggccgtgaaggccgaagaagtggccgcggcgcgc
aagcaccgcgacctgccgagcgtgcgcaccgaggccgaggccaaccgccacgacagcgcc
ctgggcccgcgcggctttgcgcaggccatgcgcgacaagatcggcgcgggccaggcggcc
gtgatcgccgaggtcaagaaggcgtcgccgtccaagggcgtgctgcgcccggacttcaag
cccgccgaaattgccggcagttatgccgaacacggcgcggcctgcctgtcggtgctgacc
gacgagcagttcttccagggccacgccgactacctgcgcgaggcccgcgccgcctgcgcg
ctgcccgtgctgcgcaaggacttcatggtcgatctgtaccaggtgtacgaggcccgctcg
tggggcgcggactgcatcctgctgatcgtcgccgccctggaccaggggctgatggtcgag
ctggaagcctgcgcgcacgaactcggcatggacgtgctggtggaagtgcacgacggccat
gagctggagcgcgcgctgcgcctgtcgacgccgctggtgggcgtcaacaaccgcaacctg
cgcaccttcgagaccacgctcgacaccacgctcggcctgctcaagcacatgccgggcgac
cgcgtcgtcgtgaccgaatcgggcatcctcaagcccgacgacgtgcacaagatgcgcgcg
gccgacgtcaacgccttcctggtcggcgaagccttcatgcgcgccgacgacccgggcgcc
gaactggcccgcctgttcacctga

DBGET integrated database retrieval system