KEGG   Ralstonia solanacearum PSI07: RPSI07_0619Help
Entry
RPSI07_0619       CDS       T01273                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01130  Biosynthesis of antibiotics
rsl01230  Biosynthesis of amino acids
Module
rsl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPSI07_0619 (trpC)
Enzymes [BR:rsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     RPSI07_0619 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CBJ49984
UniProt: D8NXF3
Position
complement(608450..609253)
Genome map
AA seq 267 aa AA seqDB search
MSDILQKILAVKAEEVAAARKHRDLPSVRTEAEANRHDSALGPRGFAQAMRDKIGAGQAA
VIAEVKKASPSKGVLRPDFKPAEIAGSYAEHGAACLSVLTDEQFFQGHADYLREARAACA
LPVLRKDFMVDLYQVYEARSWGADCILLIVAALDQGLMVELEACAHELGMDVLVEVHDGH
ELERALRLSTPLVGVNNRNLRTFETTLDTTLGLLKHMPGDRVVVTESGILKPDDVHKMRA
ADVNAFLVGEAFMRADDPGAELARLFT
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcctgcagaagatcctggccgtgaaggccgaagaagtggccgcggcgcgc
aagcaccgcgacctgccgagcgtgcgcaccgaggccgaggccaaccgccacgacagcgcc
ctgggcccgcgcggctttgcgcaggccatgcgcgacaagatcggcgcgggccaggcggcc
gtgatcgccgaggtcaagaaggcgtcgccgtccaagggcgtgctgcgcccggacttcaag
cccgccgaaattgccggcagttatgccgaacacggcgcggcctgcctgtcggtgctgacc
gacgagcagttcttccagggccacgccgactacctgcgcgaggcccgcgccgcctgcgcg
ctgcccgtgctgcgcaaggacttcatggtcgatctgtaccaggtgtacgaggcccgctcg
tggggcgcggactgcatcctgctgatcgtcgccgccctggaccaggggctgatggtcgag
ctggaagcctgcgcgcacgaactcggcatggacgtgctggtggaagtgcacgacggccat
gagctggagcgcgcgctgcgcctgtcgacgccgctggtgggcgtcaacaaccgcaacctg
cgcaccttcgagaccacgctcgacaccacgctcggcctgctcaagcacatgccgggcgac
cgcgtcgtcgtgaccgaatcgggcatcctcaagcccgacgacgtgcacaagatgcgcgcg
gccgacgtcaacgccttcctggtcggcgaagccttcatgcgcgccgacgacccgggcgcc
gaactggcccgcctgttcacctga

DBGET integrated database retrieval system