KEGG   Ralstonia solanacearum PSI07: RPSI07_0632Help
Entry
RPSI07_0632       CDS       T01273                                 

Gene name
paaF
Definition
(GenBank) enoyl-CoA hydratase-isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00071  Fatty acid degradation
rsl00280  Valine, leucine and isoleucine degradation
rsl00281  Geraniol degradation
rsl00310  Lysine degradation
rsl00360  Phenylalanine metabolism
rsl00362  Benzoate degradation
rsl00380  Tryptophan metabolism
rsl00410  beta-Alanine metabolism
rsl00627  Aminobenzoate degradation
rsl00640  Propanoate metabolism
rsl00650  Butanoate metabolism
rsl00903  Limonene and pinene degradation
rsl00930  Caprolactam degradation
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
rsl01212  Fatty acid metabolism
Module
rsl_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RPSI07_0632 (paaF)
   00650 Butanoate metabolism
    RPSI07_0632 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    RPSI07_0632 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RPSI07_0632 (paaF)
   00310 Lysine degradation
    RPSI07_0632 (paaF)
   00360 Phenylalanine metabolism
    RPSI07_0632 (paaF)
   00380 Tryptophan metabolism
    RPSI07_0632 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RPSI07_0632 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RPSI07_0632 (paaF)
   00281 Geraniol degradation
    RPSI07_0632 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RPSI07_0632 (paaF)
   00627 Aminobenzoate degradation
    RPSI07_0632 (paaF)
   00930 Caprolactam degradation
    RPSI07_0632 (paaF)
Enzymes [BR:rsl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RPSI07_0632 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: CBJ49997
UniProt: D8NXG5
Position
619384..620160
Genome map
AA seq 258 aa AA seqDB search
MSYQHILVETRGRVGLVTLNRPKALNALNDALMDELGAALLAFDADEGIGAMLITGSEKA
FAAGADIGAMADYDFATVYKNEYITRNWETIRRIRKPVIAAVAGYALGGGCELAMMCDII
LAADTAKFGQPEIKLGTMPGAGGTQRLPRAVSKAKAMDLCLSARMMGAEEAERAGLVSRV
IPADKLLDEAVAAAETIAGFSLPTVMMIKESINAAYETTLSEGVHLERRLFHSTFATEDQ
KEGMRAFLEKRQPAFRHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcctaccaacacattctggtcgaaacgcgtggtcgcgtcggtcttgttacgctcaac
cgcccgaaggcgctcaacgcgctcaacgatgcgctgatggacgaactcggcgccgcgctg
cttgccttcgatgccgatgaggggatcggtgcgatgctcatcaccggtagcgagaaggca
tttgcggccggcgcggacatcggcgccatggccgactacgacttcgccaccgtctataag
aatgaatacatcacgcgcaactgggaaaccatccgccgcatccgcaagccggtgatcgcc
gccgtggcgggctacgcgctgggcggtggctgcgaactggcgatgatgtgcgacatcatc
ctggcggccgataccgccaagtttggccagccggagatcaagctcggcaccatgccaggc
gcgggtggcacccagcgcctgccgcgcgccgtctccaaggccaaggccatggacttgtgc
ctgagcgcgcgcatgatgggcgccgaagaggctgaacgcgccggtctggtttcgcgcgtg
atccccgctgacaagcttctggatgaagccgttgctgccgccgagaccatcgctggcttc
tccctgccgaccgtcatgatgatcaaggaatcgatcaacgcggcgtacgaaaccacgctg
agcgaaggcgtgcatctggaacgccgcctgttccattccacattcgccacggaagaccag
aaagaggggatgcgcgccttcctggagaagcggcagccagctttcagacaccgctaa

DBGET integrated database retrieval system