KEGG   Ralstonia solanacearum PSI07: RPSI07_0743Help
Entry
RPSI07_0743       CDS       T01273                                 

Gene name
rnaSA
Definition
guanyl-specific ribonuclease Sa3 (RNase Sa3) (EC:3.1.27.3)
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
rsl  Ralstonia solanacearum PSI07
Brite
Enzymes [BR:rsl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     RPSI07_0743 (rnaSA)
Transfer RNA biogenesis [BR:rsl03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    RPSI07_0743 (rnaSA)
 Prokaryotic Type
    RPSI07_0743 (rnaSA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
745377..745760
Genome map
AA seq 127 aa AA seqDB search
MARGALAAMLALSVAGQPTTAAARDTTGMMAVVGTILAADLPNEAQRTLVLIGQGGPFPY
AKDGTTFGNYERRLPARKRGYYHEYTVKTRGARNRGARRIICGGDQRAANDCYYTEDHYN
SFQRIQR
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggggcgcgctggcggcgatgcttgcgctgtccgtcgccgggcagccaacgacg
gctgccgcccgggacaccaccggcatgatggcggtggtgggaaccattctcgcggcagac
ctgcccaatgaagcgcagcgcacgctggtactgatcgggcagggtggtccgtttccctat
gcgaaagatggcaccacgttcggcaattatgaacgccgtttgccggcacgaaagcgtggc
tattaccacgagtacaccgtgaagacgcgcggtgcgcgcaatcgtggcgccagacgcatc
atctgcggcggcgaccagcgcgcggccaacgattgctactacacggaagatcactacaac
agctttcaacggatacagcgatga

DBGET integrated database retrieval system