KEGG   Ralstonia solanacearum PSI07: RPSI07_1024Help
Entry
RPSI07_1024       CDS       T01273                                 

Definition
fatty acid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RPSI07_1024
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RPSI07_1024
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     RPSI07_1024
Lipid biosynthesis proteins [BR:rsl01004]
 Desaturase
  First
   RPSI07_1024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1028226..1029482
Genome map
AA seq 418 aa AA seqDB search
MTQHRQSRPGCFDHPELTTEMNLIDSFLSFLANGTLNWAWWQILIFTLVVTHITITSVTI
FLHRCQAHRALDLHPAAAHVFRFWLWLSTGMVTKEWAAIHRKHHAKCETEEDPHSPQTRG
IRKVLLEGAELYRAEAKNRETIQKFGHGTPNDWIEQNLYSKYTWQGVGLMLILDVLMFGA
VGLTVWAVQMLWIPVNAAGIINGLGHYWGYRNFDCEDASTNVFPWGLIIGGEELHNNHHT
YATSAKFSIKWYEFDVGWGYIRALEMVGLAKVKKVAPKARFGDVKPVDQNTLEAIIANRY
DVMARYAKTVKAAYRQELAKLKAARDVEYRALKPARKWFHRDEAKLGAPQREQLSQIVSD
HSALHTFVEMRRDLGALWGRSNATREQLLHQLQEWCKRAEESGIHALQEFALRLRRYA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcaccgtcaatcccgaccaggctgcttcgatcaccccgagttgaccacggag
atgaacttgatcgactcctttctgagttttcttgccaacggtaccctgaactgggcctgg
tggcagatcctgattttcacgctggtggtgacgcacatcaccatcaccagcgtcacgatt
ttcctgcaccgctgtcaggcacaccgcgcgctggatctgcacccggctgccgcccacgtc
ttccgcttctggctctggctgagcaccggcatggtcaccaaggagtgggctgccatccac
cgcaagcaccacgccaagtgcgaaaccgaagaggatccgcacagcccgcagacacggggc
atccgcaaggtgctgctggaaggcgccgagctgtaccgtgccgaggccaagaaccgcgag
accatccagaagttcggtcacggcacccccaacgactggatcgagcaaaacctctattcc
aagtacacctggcagggcgtcggcctgatgctgatcctcgacgtgctgatgttcggcgcg
gtcggcctgaccgtgtgggcggtgcagatgctgtggattccggtcaatgccgccggcatc
atcaacgggctgggccactactggggctatcgcaacttcgactgtgaagatgcttcgacc
aacgtgttcccgtggggtctgatcatcggcggtgaagagctgcacaacaatcaccacacc
tacgccacgtcggccaagttctcgatcaagtggtacgagttcgacgtgggttggggctat
atccgtgcgttggagatggtgggtctggccaaggtcaagaaggtggcgcccaaggcacgc
ttcggcgacgtcaagccggttgaccagaacacgctggaagccatcatcgctaaccgctac
gacgtgatggcccgctacgccaagaccgtcaaggccgcctatcgccaggagctggccaag
ctgaaggccgcccgcgatgtggaataccgcgcgctgaagccggcccgcaagtggttccat
cgcgatgaagccaagctgggtgcaccccagcgcgagcaactgtcgcagatcgtgtcggat
cattccgcgctgcacaccttcgtcgagatgcgccgcgacctgggcgcgctgtggggccgt
tcgaacgccacgcgcgaacaactgctgcaccagttgcaggaatggtgcaagcgcgcggag
gaaagcggtatccatgcgctgcaggaattcgccctgcgcctgcgccggtacgcctga

DBGET integrated database retrieval system