KEGG   Ralstonia solanacearum PSI07: RPSI07_1116Help
Entry
RPSI07_1116       CDS       T01273                                 

Definition
bifunctional uroporphyrin-III c-methyltransferase and uroporphyrinogen-III synthase transmembrane protein (EC:2.1.1.107 4.2.1.75)
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RPSI07_1116
Enzymes [BR:rsl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     RPSI07_1116
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RPSI07_1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1128348..1130441
Genome map
AA seq 697 aa AA seqDB search
MDDRSPSPSSVPPGALPHPSAPVVVVTRPRTQAPMLVAALERHGLRTLQFPLLDIAPTPN
LDDLRAALADPSRYALVVFVSPNAVQQAFSAMPEGFRWPQDVPVAVVGPASAQALAAHGV
EPPTYRVIRPDSHADEARQDSEALYARLDLAPLSGREMLIVRGNGGREWLADRLREAGVA
VRTVEAYRRSVPVPDAATWAALREVLAGRHAWTLTSSEAVRNLDSLARASLTAAEVDTLH
AAPCFAPHARIVEQAQSLGFHDVTLTGAGDDRLLAGLLAWAGLVAPAAEAGPSPAPAAAP
AESKPSSPAPTVSQTSVPSSVPAPGPAAASPGPAAAPAAPTMTVSAGPGRGNWLLWTALI
LVLVVVAGLQVRNERLAREVRQRTQQNETLAQEMRVLSRADQDAFAQLQQKFGALDARTA
ETRERQGTLEQASQDLLRNRDDWQRAEIERSLEVASEQLQLTGNVSAALAALQTIDARLA
ALDKPQFRAMRRAVARDIAKLKALPAIDLSGASIRLDDAINGIDALPLVSSASPLGSGQA
AQASRGHPAKPGKAVSAASASTPAASVATEAGWSAGVRAWWSRLWHDVRSELGQIVQVRR
VDQTEALLLSSDQAWFLRENLKLWLMNARLALLSRNEAVFRADLGRADTLLARYFDTQSP
RVAAVQNLLQQARASVGTLEVPTLADSLAAVRGQGKE
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggacgaccgctcgccctctccatccagcgtgccgcccggcgctctcccgcatccttcc
gcgcccgtcgtcgtcgtcacgcggccgcgcacgcaggcgccgatgctggtcgccgcgctg
gagcgccacgggctgcgcacgctccagtttccgctgctcgacatcgcaccgacacccaac
ctggatgacctgcgtgccgcgctggccgacccgtcgcgctatgcgctggttgtgttcgtc
agccccaatgccgtgcaacaggcgttttcggccatgcccgaaggcttccgctggccgcag
gatgtaccagtcgcggtggtgggccccgccagcgcccaggccctggccgcgcatggcgtc
gagccgcccacgtaccgcgtgatccggcccgactcgcatgccgacgaggcgcggcaggat
tccgaggcgctgtatgcgcgcctggacctggcgccgctgagcggccgcgagatgctgatc
gtgcgcggcaacggcggccgcgaatggctggccgaccggctgcgcgaagccggcgtcgcg
gtgcgcacggtggaagcgtatcggcgcagtgtcccggtgcccgatgccgcgacctgggcc
gcgctgcgcgaggtgctggccggccgccacgcctggacgctgaccagctccgaagcggtg
cgcaatctcgacagcctcgcgcgcgccagcctgaccgccgccgaagtcgacacgctgcac
gccgcgccatgcttcgcgccgcacgcccgcatcgtcgaacaggcgcagtcgctgggcttc
catgacgtaacactgaccggcgccggcgacgaccgcctgctggctggcctgctcgcctgg
gccggactcgtcgcgcccgccgccgaggccgggccgtcgccagcccccgcggcggcgccg
gccgaatcgaaaccttcctcacctgctccgaccgtgtcgcagacttccgttccctcgtcc
gttcccgcaccgggcccggcagccgcctcgccggggccggctgccgcccctgccgccccg
accatgaccgtcagcgccggacccggacgcgggaactggctgctttggactgcgctgatc
ctggtgctagtggtggtggccggactgcaggtccgcaatgagcggctggcgcgcgaggtc
cgccagcgcacgcagcagaacgagacgctggcgcaggagatgcgcgtgctgtcgcgcgcc
gatcaggacgcctttgcccagctgcagcagaagttcggcgcgctggacgcccgcaccgcc
gaaacacgcgagcgccagggcacgctcgagcaggccagccaggatctgctgcgcaaccgc
gacgattggcagcgggccgagatcgaacgctcgctcgaagtcgcttccgaacaattacag
ctcaccggcaacgtgagcgccgcgctggccgcgctgcagaccatcgacgcgcgcctggcc
gcgctcgacaagccgcagttccgagccatgcgccgcgccgttgctcgcgacatcgccaag
ctcaaggcgctgccggccatcgacctgtcgggcgcctcgatccgcctggatgatgcgatc
aacggcatcgatgcgctgccgctggtgtcgtccgcctcgccgctggggtcggggcaggcc
gcacaggcgtcgcgtggccatccagccaagccgggcaaggccgtgtccgcagcgtcggct
tcgacgcccgctgcgtcggtggcgacggaggccggctggtcggccggcgtgcgcgcctgg
tggagccgcctgtggcacgacgtgcgcagcgagctgggccagatcgtgcaggtgcgccgc
gtcgaccagaccgaggcgctgctgctgtcgtccgatcaggcgtggttcctgcgcgagaac
ctcaagctgtggctgatgaacgcgcggctggcgctgctgtcgcgcaacgaggccgtgttc
cgcgccgacctcggccgcgccgacacgctgctcgcgcgctacttcgatacgcagtcgccg
cgcgtggcggccgtgcagaacctgctgcagcaggcgcgcgcgagcgtcggcacgctggag
gtgccgaccttggccgacagcctcgccgccgtccgcggccagggcaaggagtga

DBGET integrated database retrieval system