KEGG   Ralstonia solanacearum PSI07: RPSI07_1269Help
Entry
RPSI07_1269       CDS       T01273                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rsl00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1294814..1295479
Genome map
AA seq 221 aa AA seqDB search
MPSSQAHSAVETPIENHFPGSLFMVVAPSGAGKSTLVNALLAQDPSIRLSVSATTRKPRA
GEQHGREYNFMTVDEFKACRDRGEFLEWAEVHGNYYATSRVWIEEQMRAGTDVLLEIDWQ
GAQQVHRRFANAVEIFILPPSLTALEDRLKKRGQDEPNVIVRRLLAAGSEMAHAPEADYV
IINEVFETALAELRTVVQATRLRYMAQKARHAELFVELGIH
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgccttcttcccaagcgcactcggcggtcgagacgcccatcgagaaccacttccccggc
agcctgttcatggtggtggcgccttccggcgcgggcaagtcgacgctggtgaacgcgctg
ctggcgcaggacccgtcgatccgcctgtccgtctccgccaccacgcgcaagccgcgagcg
ggcgagcagcacggtcgcgaatacaacttcatgacggtcgacgagttcaaggcctgccgc
gatcgcggcgagtttctcgagtgggccgaagtgcacggcaactactacgcgacgtcgcgc
gtgtggatcgaagagcagatgcgtgccggcaccgacgtgctgctggagatcgactggcag
ggcgcgcagcaggtgcatcgccgcttcgccaatgccgtcgagatcttcatcctgccgccg
tcgctgaccgcgctcgaagaccgcctcaagaagcgcggccaggacgagcccaacgtgatc
gtgcgccggctgctcgccgcgggcagcgaaatggcgcatgcgcccgaggccgactacgtg
atcatcaacgaggtcttcgagaccgcgctggctgaactgcgcaccgtggtgcaggccacg
cggctgcgctatatggcgcagaaggcgcgacacgccgaactcttcgttgagctgggcatt
cactga

DBGET integrated database retrieval system