KEGG   Ralstonia solanacearum PSI07: RPSI07_1269Help
Entry
RPSI07_1269       CDS       T01273                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase (GMP kinase)
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00230  Purine metabolism
rsl01100  Metabolic pathways
Module
rsl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RPSI07_1269 (gmk)
Enzymes [BR:rsl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RPSI07_1269 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 RsgA_GTPase MMR_HSR1 AAA_22 AAA_16 ABC_tran AAA_25 AAA_29 AAA_30 Septin AAA_23 cobW AAA_18 Dynamin_N GTP_EFTU Viral_helicase1
Motif
Other DBs
NCBI-ProteinID: CBJ50629
UniProt: D8P131
Position
1294814..1295479
Genome map
AA seq 221 aa AA seqDB search
MPSSQAHSAVETPIENHFPGSLFMVVAPSGAGKSTLVNALLAQDPSIRLSVSATTRKPRA
GEQHGREYNFMTVDEFKACRDRGEFLEWAEVHGNYYATSRVWIEEQMRAGTDVLLEIDWQ
GAQQVHRRFANAVEIFILPPSLTALEDRLKKRGQDEPNVIVRRLLAAGSEMAHAPEADYV
IINEVFETALAELRTVVQATRLRYMAQKARHAELFVELGIH
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgccttcttcccaagcgcactcggcggtcgagacgcccatcgagaaccacttccccggc
agcctgttcatggtggtggcgccttccggcgcgggcaagtcgacgctggtgaacgcgctg
ctggcgcaggacccgtcgatccgcctgtccgtctccgccaccacgcgcaagccgcgagcg
ggcgagcagcacggtcgcgaatacaacttcatgacggtcgacgagttcaaggcctgccgc
gatcgcggcgagtttctcgagtgggccgaagtgcacggcaactactacgcgacgtcgcgc
gtgtggatcgaagagcagatgcgtgccggcaccgacgtgctgctggagatcgactggcag
ggcgcgcagcaggtgcatcgccgcttcgccaatgccgtcgagatcttcatcctgccgccg
tcgctgaccgcgctcgaagaccgcctcaagaagcgcggccaggacgagcccaacgtgatc
gtgcgccggctgctcgccgcgggcagcgaaatggcgcatgcgcccgaggccgactacgtg
atcatcaacgaggtcttcgagaccgcgctggctgaactgcgcaccgtggtgcaggccacg
cggctgcgctatatggcgcagaaggcgcgacacgccgaactcttcgttgagctgggcatt
cactga

DBGET integrated database retrieval system