KEGG   Ralstonia solanacearum PSI07: RPSI07_1365Help
Entry
RPSI07_1365       CDS       T01273                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPSI07_1365 (tpiA)
   01230 Biosynthesis of amino acids
    RPSI07_1365 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPSI07_1365 (tpiA)
   00051 Fructose and mannose metabolism
    RPSI07_1365 (tpiA)
   00562 Inositol phosphate metabolism
    RPSI07_1365 (tpiA)
Enzymes [BR:rsl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RPSI07_1365 (tpiA)
Exosome [BR:rsl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RPSI07_1365 (tpiA)
  Exosomal proteins of bladder cancer cells
   RPSI07_1365 (tpiA)
  Exosomal proteins of melanoma cells
   RPSI07_1365 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1399562..1400308
Genome map
AA seq 248 aa AA seqDB search
MSARPKLVVGNWKLHGSLNGNAELLEKIKAAGQARAALAVCAPFPYLAQCQSLLAGSAVA
WGAQDVSAETRGAFTGEVAASMLSEFGCGYVIVGHSERRTYHAETDAQVATKALRALEHG
ITPIVCVGETLVQREAGETEQVVARQLDAVLESLSLEQLGRIVVAYEPVWAIGTGKTATS
EQAQAVHAFLRGRVAACDAGVAQRMPILYGGSVKPDNAAELFSMADIDGGLIGGASLKAE
DFLVIGRA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcaagaccgaagctggtggtgggcaactggaagttgcatggtagcctgaacggc
aacgccgaactgcttgagaagatcaaggcggccggccaggcccgcgccgcgctggcggtc
tgtgcgccgttcccgtacttggcccaatgccagtcgctgctcgccggctcggcggtggcc
tggggtgcgcaggatgtgtcggctgagacgcgcggcgccttcaccggcgaggtggcggca
tcgatgctgtcggaattcggctgcggctacgtgatcgtcgggcattccgagcgccgtacg
tatcacgctgagaccgacgcgcaagtggcgaccaaggcgctgcgcgcgctggagcacggc
atcaccccgatcgtctgtgtcggcgaaacgctggtgcagcgcgaagccggggaaaccgag
caagtcgtggcccgtcagctggacgcggtgctggagtcgctgtcgctcgagcagctgggc
cgcatcgtcgtggcctatgagccggtctgggccattggtaccggcaagaccgcgaccagc
gagcaggcgcaggcggtgcatgctttcctgcgtggccgcgtggctgcctgcgacgccggt
gtcgcgcagcgcatgccgattctgtacggtggcagcgtcaagccggacaacgcggccgaa
ctgttttcgatggcggacatcgatggcggcctgatcggcggcgcatccctgaaggccgaa
gatttcctggtgatcggccgggcctga

DBGET integrated database retrieval system