KEGG   Ralstonia solanacearum PSI07: RPSI07_1448Help
Entry
RPSI07_1448       CDS       T01273                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPSI07_1448 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPSI07_1448 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPSI07_1448 (trpA)
Enzymes [BR:rsl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RPSI07_1448 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1482691..1483488
Genome map
AA seq 265 aa AA seqDB search
MSRIAHTFSQLSAQGRKGLIPFITAGDPYPELTVDLMHALVKGGANVIELGVPFSDPMAD
GPVIQRASERALAKKVGLRTVLDYVRAFRATDKTTPVVLMGYANPIERMGIDAFAKAASE
AGVDGVLVVDYPPEECEAFAKTMQATGIDPIFLLAPTSTEARIAQIARVASGYIYYVSLK
GVTGAATLDLDSVAARIPQIRQHARLPVGVGFGIRDAATARAIGGVADAVVIGSRIVQLL
EEAPREQAVQCLTDFIADIRQALDA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcatcgctcacactttctcgcaactgtccgcgcagggccgcaagggcctgatt
ccgttcatcacggcgggcgatccctaccccgaactgaccgtcgacctgatgcacgcgctg
gtcaaggggggcgccaacgtcattgaactgggcgtgccgttttccgacccgatggccgac
ggcccggtcatccagcgtgcgtcggagcgcgcacttgccaagaaggttggcttgcgcacc
gtgctggattacgtccgtgcgttccgcgctaccgacaagacgacgcccgtggtgctgatg
ggctacgccaacccgatcgagcgcatgggcatcgatgccttcgcgaaggccgcgtcggaa
gccggtgtggatggcgtgctggtggtcgactacccgcccgaggaatgcgaggcgttcgcc
aagaccatgcaggccacgggcatcgacccgatcttcctgctggcgcccacgtcgaccgaa
gcgcgtatcgcgcagatcgcccgcgtggcgagcggctacatctactacgtctcgctcaag
ggcgtgacgggggcggcgacgctggacctcgacagcgtggcggcgcgcatcccgcagatc
cggcagcatgcgcggctgccggtgggcgtcggcttcggcatccgggatgcggcaaccgca
cgtgcgatcggtggcgtggccgatgcggtggtgatcggatcccgcattgtgcaattgctg
gaggaggccccccgcgaacaagcggtacaatgtctgactgatttcatcgcggacatccgc
caggcgctcgacgcctga

DBGET integrated database retrieval system