KEGG   Ralstonia solanacearum PSI07: RPSI07_1448Help
Entry
RPSI07_1448       CDS       T01273                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00260  Glycine, serine and threonine metabolism
rsl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01130  Biosynthesis of antibiotics
rsl01230  Biosynthesis of amino acids
Module
rsl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPSI07_1448 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RPSI07_1448 (trpA)
Enzymes [BR:rsl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RPSI07_1448 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Peripla_BP_6 His_biosynth Peptidase_M15_3 PcrB
Motif
Other DBs
NCBI-ProteinID: CBJ50809
UniProt: D8P1R0
Position
1482691..1483488
Genome map
AA seq 265 aa AA seqDB search
MSRIAHTFSQLSAQGRKGLIPFITAGDPYPELTVDLMHALVKGGANVIELGVPFSDPMAD
GPVIQRASERALAKKVGLRTVLDYVRAFRATDKTTPVVLMGYANPIERMGIDAFAKAASE
AGVDGVLVVDYPPEECEAFAKTMQATGIDPIFLLAPTSTEARIAQIARVASGYIYYVSLK
GVTGAATLDLDSVAARIPQIRQHARLPVGVGFGIRDAATARAIGGVADAVVIGSRIVQLL
EEAPREQAVQCLTDFIADIRQALDA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgcatcgctcacactttctcgcaactgtccgcgcagggccgcaagggcctgatt
ccgttcatcacggcgggcgatccctaccccgaactgaccgtcgacctgatgcacgcgctg
gtcaaggggggcgccaacgtcattgaactgggcgtgccgttttccgacccgatggccgac
ggcccggtcatccagcgtgcgtcggagcgcgcacttgccaagaaggttggcttgcgcacc
gtgctggattacgtccgtgcgttccgcgctaccgacaagacgacgcccgtggtgctgatg
ggctacgccaacccgatcgagcgcatgggcatcgatgccttcgcgaaggccgcgtcggaa
gccggtgtggatggcgtgctggtggtcgactacccgcccgaggaatgcgaggcgttcgcc
aagaccatgcaggccacgggcatcgacccgatcttcctgctggcgcccacgtcgaccgaa
gcgcgtatcgcgcagatcgcccgcgtggcgagcggctacatctactacgtctcgctcaag
ggcgtgacgggggcggcgacgctggacctcgacagcgtggcggcgcgcatcccgcagatc
cggcagcatgcgcggctgccggtgggcgtcggcttcggcatccgggatgcggcaaccgca
cgtgcgatcggtggcgtggccgatgcggtggtgatcggatcccgcattgtgcaattgctg
gaggaggccccccgcgaacaagcggtacaatgtctgactgatttcatcgcggacatccgc
caggcgctcgacgcctga

DBGET integrated database retrieval system