KEGG   Ralstonia solanacearum PSI07: RPSI07_1536Help
Entry
RPSI07_1536       CDS       T01273                                 

Definition
polyphenol oxidase oxidoreductase protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    RPSI07_1536
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    RPSI07_1536
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     RPSI07_1536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1562162..1563394
Genome map
AA seq 410 aa AA seqDB search
MRIDFTINNGGDASARYLTWAPSPLRLRLLDATPGPDVVVTLSEDRQPNGGSVRFGATQG
GNYTPTLKVSMPTNGASVVVYVRGKFGTPSQADGDVSIVVSGPTSELGRLPVMVRVRKNA
NQLTPAERNRFISAMAQLNNRGTGRFADFRNMHVAGRADQQAHGGPGFLPWHRAYLLDLE
RELQAIDPAVTIPYWRFDRPAPNLFTTDFIGVPDALGTVGFSPANPLQFWATDGVQGILR
RQLGASPGAQADPSIRTEAQTLALGSSYQNFRTMQGNPHGSAHVSYFGGSISSIPTAAKD
PLFFLLHCNVDRLWAKWQSQAGRYDVNVAAAYDSGPTPTSLLAGHNLKDTLWPWNGIVTP
PRPSTAPGGPMADSSCVSAPGFNPLVSDMLDFQGVVNSSAKLGFAYDDVP
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcgacttcacgatcaacaacggtggcgatgcctcagcccgctacctcacctgg
gcgccgtcgccactacgacttcgccttctcgatgccacaccgggtccggatgtggtcgtg
acgctttcggaagaccgccagcccaatggcggttcggtccggttcggtgcgacgcagggc
ggcaactacacgccgacactcaaagtctcgatgccgacaaacggcgcgtccgtggtggtc
tacgtccgagggaaattcggcacgcccagtcaggccgatggcgatgtgagtatcgtggtc
agcgggccgacgtcggaacttggccgattgcccgtcatggtgcgggtgcgcaagaacgcg
aatcagctcacccccgccgagcgcaaccgcttcatctcggccatggctcaactcaataac
cgggggacagggcggttcgccgatttccgcaacatgcacgtcgcgggccgagccgatcag
caggcccatggcggccccggcttcctgccgtggcaccgggcctatctgctggatctggag
cgcgagttgcaagccatcgaccccgcggtgacgattccgtattggcgcttcgatcggcct
gcgccgaatttgttcaccaccgacttcatcggcgtgccggacgcactcggcacggtgggt
ttcagtccggccaacccgctgcagttctgggccaccgatggcgtacaagggatcctgagg
cgtcagttgggcgcgagtccaggtgcgcaggccgacccgagcatcaggaccgaagcccag
acgctggcgctcggcagttcataccagaatttcaggaccatgcagggcaacccgcacggc
tccgcccatgtcagttattttggcggcagcatctcgtcgatcccgacagccgccaaagat
ccgctgttcttcctgctgcactgcaatgtcgacaggttgtgggccaaatggcagtcgcag
gcggggcggtacgatgtgaatgtggcggctgcctatgactccgggcccacgccaacgagc
ctgcttgcagggcacaatctcaaggatacgctgtggccgtggaacggcatcgtgacgccg
ccccggccgtcgactgctcccggtggccccatggctgattcgtcttgcgtctcggcgcct
gggttcaatcctctggtcagcgacatgcttgacttccagggggtggtgaacagttcggcc
aagcttggctttgcctacgacgatgtgccctga

DBGET integrated database retrieval system