KEGG   Ralstonia solanacearum PSI07: RPSI07_1568Help
Entry
RPSI07_1568       CDS       T01273                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rsl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1592435..1593343
Genome map
AA seq 302 aa AA seqDB search
MLRAPCSESRTLSASIPTTTHFQCGRFRYARDRRPLVMGILNVTPDSFSDGGQHATRDAA
LRHAEQLIAEGADLVDIGGESSRPGAAPLGLQEELDRVMPIVEALRDCGRPLSIDTYKPE
VMRATLDGGADLINDIWGFRKPGAIEAVAQGRAGLCLMHMQRDPETMQEAPNYVDLMAEV
EAFLQSQAEALLAAGVAAERIALDPGFGFGKTPDHNLIMLNRLEHFERMGLPLLVGLSRK
STLGAVLGGKPPAERVTASVAAALLAAERGAFIVRVHDVRPTVEAIQFWWAMRHERVDPP
VA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgggcgccgtgttctgagtcacgtaccttgtctgcttccattcccaccacgacg
catttccagtgcggacgcttccgctacgcgcgtgaccggcgcccgctggtcatgggcatc
ctcaacgtcacgcccgattcgttttccgacggcggccagcatgccacccgcgatgccgca
ttgcgccacgccgagcagctgatcgccgaaggggccgatcttgtcgacatcggcggcgag
tcgagccggcccggggctgcgccgctcgggctgcaggaggagctggatcgggtgatgccg
atcgtcgaggcgctgcgcgattgcggcaggccgctgtcgatcgacacctacaagccggag
gtgatgcgcgccacgctcgatggcggtgccgacctgatcaacgatatctggggattccgc
aagccgggggcgatcgaggccgtcgcgcagggccgtgccgggctgtgcctgatgcacatg
cagcgcgatcccgaaacgatgcaggaagcccccaactacgtggacctgatggccgaagtc
gaggccttcctgcaatcgcaggcggaagcgctgctggcagcgggcgtcgcggccgaacgc
atcgcgctggacccgggatttggctttgggaagacgccggaccacaatctgatcatgctc
aaccggctggagcacttcgagcggatgggcctgccgttgctggtgggcctgtcgcgcaag
tcgacgctgggcgcggtgctgggcggcaagccgcccgccgagcgcgtcacggcgagcgtt
gcggcagccttgctggcggcggagcggggggctttcatcgtgcgggtccacgatgtgcgg
ccgaccgtcgaggccatccagttctggtgggccatgcggcacgagcgggtcgatccgccg
gttgcatga

DBGET integrated database retrieval system