KEGG   Ralstonia solanacearum PSI07: RPSI07_1568Help
Entry
RPSI07_1568       CDS       T01273                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RPSI07_1568 (folP)
Enzymes [BR:rsl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     RPSI07_1568 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1592435..1593343
Genome map
AA seq 302 aa AA seqDB search
MLRAPCSESRTLSASIPTTTHFQCGRFRYARDRRPLVMGILNVTPDSFSDGGQHATRDAA
LRHAEQLIAEGADLVDIGGESSRPGAAPLGLQEELDRVMPIVEALRDCGRPLSIDTYKPE
VMRATLDGGADLINDIWGFRKPGAIEAVAQGRAGLCLMHMQRDPETMQEAPNYVDLMAEV
EAFLQSQAEALLAAGVAAERIALDPGFGFGKTPDHNLIMLNRLEHFERMGLPLLVGLSRK
STLGAVLGGKPPAERVTASVAAALLAAERGAFIVRVHDVRPTVEAIQFWWAMRHERVDPP
VA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgggcgccgtgttctgagtcacgtaccttgtctgcttccattcccaccacgacg
catttccagtgcggacgcttccgctacgcgcgtgaccggcgcccgctggtcatgggcatc
ctcaacgtcacgcccgattcgttttccgacggcggccagcatgccacccgcgatgccgca
ttgcgccacgccgagcagctgatcgccgaaggggccgatcttgtcgacatcggcggcgag
tcgagccggcccggggctgcgccgctcgggctgcaggaggagctggatcgggtgatgccg
atcgtcgaggcgctgcgcgattgcggcaggccgctgtcgatcgacacctacaagccggag
gtgatgcgcgccacgctcgatggcggtgccgacctgatcaacgatatctggggattccgc
aagccgggggcgatcgaggccgtcgcgcagggccgtgccgggctgtgcctgatgcacatg
cagcgcgatcccgaaacgatgcaggaagcccccaactacgtggacctgatggccgaagtc
gaggccttcctgcaatcgcaggcggaagcgctgctggcagcgggcgtcgcggccgaacgc
atcgcgctggacccgggatttggctttgggaagacgccggaccacaatctgatcatgctc
aaccggctggagcacttcgagcggatgggcctgccgttgctggtgggcctgtcgcgcaag
tcgacgctgggcgcggtgctgggcggcaagccgcccgccgagcgcgtcacggcgagcgtt
gcggcagccttgctggcggcggagcggggggctttcatcgtgcgggtccacgatgtgcgg
ccgaccgtcgaggccatccagttctggtgggccatgcggcacgagcgggtcgatccgccg
gttgcatga

DBGET integrated database retrieval system