KEGG   Ralstonia solanacearum PSI07: RPSI07_1661Help
Entry
RPSI07_1661       CDS       T01273                                 

Gene name
bdhA
Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00072  Synthesis and degradation of ketone bodies
rsl00650  Butanoate metabolism
rsl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RPSI07_1661 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RPSI07_1661 (bdhA)
Enzymes [BR:rsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     RPSI07_1661 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: CBJ51021
UniProt: D8NT70
Position
1675279..1676058
Genome map
AA seq 259 aa AA seqDB search
MLQGKTALVTGSTSGIGLGIACALAAQGANIIMNGFGDVDGPKAQIAAAGKHAIRVGYHG
ADMSKPAEIEAMFAYADAEFGGVDILVNNAGIQYVANVEDFPAERWDAIIAINLSSAFHT
TRLAVPGMKRKNWGRVVNIASAHGLVASAQKSAYVAAKHGIVGLTKAVALETAQTGITVN
AICPGWVLTPLVQKQIDARAEKEGIPVLQAKKELLMEKQPSGEFVSPEQLGALAVFLCSE
AAEQVRGVAWNMDGGWVAQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaggaaaaaccgccctggtgaccggctccaccagcggcatcggcctgggcatc
gcctgcgcgctcgcggcgcaaggtgccaacatcatcatgaacggctttggcgacgtggac
gggcccaaggcccagatcgccgcggccggcaagcacgccatccgcgtcggctaccacggc
gccgacatgagcaagccggcagagatcgaggcgatgttcgcctacgccgatgccgagttc
ggcggcgtggacattctcgtcaacaatgccggcatccagtatgtggccaacgtggaagac
ttcccggccgagcgctgggacgccatcattgccatcaacctgtcgtcggcgttccatacc
acgcggctcgcggtgccgggcatgaagcgcaagaactggggacgcgtcgtcaacatcgcg
tcggcgcacgggctggtggcgtccgcgcagaagtcggcttacgtggcggccaagcacggc
atcgtcggcctgaccaaggcggtggcactggagaccgcgcagaccggcatcaccgtcaac
gcgatctgcccgggctgggtgctgacgccgctggtgcagaagcagatcgacgcacgcgcc
gagaaagagggcattcccgtcctgcaggccaagaaggagctgctcatggagaagcagccc
tcgggagaattcgtttcgcccgagcagctcggcgcgctggcggtgttcctgtgcagcgag
gccgccgagcaggtgcgcggcgtggcgtggaacatggacggcggctgggtcgctcagtaa

DBGET integrated database retrieval system