KEGG   Ralstonia solanacearum PSI07: RPSI07_1691Help
Entry
RPSI07_1691       CDS       T01273                                 

Gene name
pdhB
Definition
dihydrolipoyllysine-residue succinyltransferase, component of pyruvate dehydrogenase complex (E2) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:rsl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rsl00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rsl00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rsl00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1708389..1710059
Genome map
AA seq 556 aa AA seqDB search
MSQVVEIKVPDIGDYKDVPVIEVHVKAGDTVSAEDSLVTLESDKATMDVPSPKSGVVREL
KVKVGDAVSEGSLVLLLEEAGARRFRPPRQRPHRLRPLQRLRRWRRPRARSAAQPAAGGG
TIEVKVPDIGDYTDVPVIEISVKVGDKVEAEQSLITLESDKATMDVPSPVAGTVKDIRVK
VGDAVSEGTLIVVLEGAGSAAAPASAVAQAPAPAPAAIAPSPAPVAPAAAPAAAPVTYTA
DAVGTVGKAAHASPSVRKYARELGVDVNLVGGTGPKNRITQDDVQRYVKGVMTGQAAAPG
KAAAAAAPAGGGELNLLPWPKVDFTKFGPVEPKPLSRIKKISGANLHRNWVMIPHVTNND
EADITELEAFRVQMNKEHEKAGVKFTMLAFVIKAVVGALKKFPTFNASLDGDNLVFKQYY
HVGFAADTPNGLVVPVIRDADKKGVVDIAKEMAELSKAAREGKLKPDQMQGGCFSISSLG
GIGGTHFTPIINAPEVAILGLSRGYQKPVWDGKQFMPRLTLPLSLSYDHRVIDGAEAARF
NAYLAAVLADFRRVLL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagtcgtagaaatcaaggtgccggacatcggcgactacaaggacgtgccggtc
atcgaggtgcacgtcaaggcgggtgataccgtcagcgccgaggattcgctggtcacgctg
gagtcggacaaggcgaccatggatgtgccgtcgcccaagagcggcgtcgtcagagaactg
aaggtcaaggtgggcgacgccgtgtcggagggttcgctggtgctgctgctcgaagaagca
ggcgcgcggcggttccggccgcccaggcagcgcccgcaccggctccggccgctccagcgc
ctgcgccggtggcgcaggccccgcgcccgttccgcggcccagcccgcggcaggcggtggc
acgatcgaagtgaaggtgccggacatcggcgactacacggacgtgccggtcatcgagatc
agcgtgaaggtgggcgacaaggtggaagccgagcagtcgctgatcacgctcgaatccgac
aaagccacgatggatgtaccgtcgccggttgccggcacggtcaaggacatccgcgtgaag
gtgggcgatgccgtgtcggaaggcacgctgatcgtcgtgctggaaggcgcgggcagcgcc
gccgctccggcgtccgctgtggcacaggcgccggcaccggctcccgccgcaattgcgccg
agcccggctccggtggctcccgccgccgctccggccgcagcgcccgtcacgtacaccgcc
gacgcggtcggtacggtcggcaaggccgcgcatgccagcccctcggtgcgcaaatacgcg
cgcgaactgggcgtggacgtgaacctggtcggcggcaccggtccgaagaaccgcatcacg
caggacgacgtgcagcgctacgtcaagggcgtgatgaccggccaggccgcggcgccgggc
aaggccgctgctgcggcggcaccggccggcggcggcgaactgaacctgctgccgtggccg
aaggtggacttcaccaagttcggcccggtcgagcccaagccgctgtcgcgcatcaagaag
atctccggcgcgaacctgcatcgcaactgggtcatgatcccgcacgtcaccaacaacgac
gaagcggacatcaccgagctggaagccttccgcgtgcagatgaacaaggagcacgaaaag
gccggcgtgaagttcaccatgctggcgttcgtgatcaaggcggtcgtgggcgcgctcaag
aagttcccgaccttcaatgccagcctggacggcgacaacctggtcttcaagcagtactac
cacgtcggttttgccgccgacacgcccaacgggctggtggtgccggtgatccgcgacgcc
gacaagaagggcgtggtggacatcgcgaaggaaatggccgagctctccaaggccgcgcgc
gaaggcaagctcaagccggaccagatgcagggcggctgcttctcgatctcgtcgctgggc
ggcatcggcggcacgcatttcacgccgatcatcaacgcgccggaagtggccatcctgggc
ctgtcgcgcggctaccagaaaccggtgtgggacggcaaacagttcatgccgcgcctgacg
ctgccgctgtcgctgtcgtacgatcaccgcgtgatcgacggggcggaagccgcacgcttc
aacgcgtacctggcggccgtactggcggacttccgccgcgtgctgctataa

DBGET integrated database retrieval system