KEGG   Ralstonia solanacearum PSI07: RPSI07_1762Help
Entry
RPSI07_1762       CDS       T01273                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RPSI07_1762
Enzymes [BR:rsl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RPSI07_1762
   3.1.2  Thioester hydrolases
    3.1.2.-  
     RPSI07_1762
Lipid biosynthesis proteins [BR:rsl01004]
 Fatty acid synthase
  Component type
   RPSI07_1762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1784653..1785312)
Genome map
AA seq 219 aa AA seqDB search
MGWMALAAALGCAMIGIPPTAHATAAQGSASAPRRVVVLGDSLSAGYGLVQGTGWVALLG
NRLKEQKLDYSVANASISGDTTAGGRARLPAVLAREKPAVVVLELGANDALRGLSLSASE
ANLKAMIEASQAAGARVLLVGMRIPPNYGADYSERFFAMFSKLAQQYRLPLVPFLLEGVA
QRPDWFQEDRIHPVAAAQPTLLDNIWPKLEPLLKGRVGG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgggatggatggcactcgcggccgcgctcggctgcgcgatgatcggcatcccgccaacg
gcgcacgcgacggcagcacagggcagcgcatcggcaccgcgccgtgtggtggtgctgggc
gacagcctgtcagcgggatacggcctggtgcaaggcaccggctgggtcgcactgctgggc
aaccgcctcaaagaacagaagctcgattatagcgtcgccaatgccagcatcagcggcgac
accaccgcaggcgggcgcgctcgcctgccggccgtgcttgcgcgcgagaaacctgccgtg
gtggtgctcgaactgggtgccaacgatgcgctgcgcgggctgtcgctgtctgccagcgaa
gccaacctgaaggcgatgatcgaggcatcgcaagccgccggcgccagggtgctgctggtc
ggcatgcgcatcccgcccaattacggcgcggactacagtgaacgcttcttcgccatgttc
agcaaactggcgcagcagtacaggctgccgctggtgcccttcctcctggaaggcgtggcc
cagcggcccgactggttccaggaggatcgcatccacccggtcgcggcggcgcagccgacg
ctgctcgacaatatctggcccaagcttgaaccgctactcaagggccgggtcggaggatga

DBGET integrated database retrieval system