KEGG   Ralstonia solanacearum PSI07: RPSI07_1762Help
Entry
RPSI07_1762       CDS       T01273                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rsl01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1784653..1785312)
Genome map
AA seq 219 aa AA seqDB search
MGWMALAAALGCAMIGIPPTAHATAAQGSASAPRRVVVLGDSLSAGYGLVQGTGWVALLG
NRLKEQKLDYSVANASISGDTTAGGRARLPAVLAREKPAVVVLELGANDALRGLSLSASE
ANLKAMIEASQAAGARVLLVGMRIPPNYGADYSERFFAMFSKLAQQYRLPLVPFLLEGVA
QRPDWFQEDRIHPVAAAQPTLLDNIWPKLEPLLKGRVGG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgggatggatggcactcgcggccgcgctcggctgcgcgatgatcggcatcccgccaacg
gcgcacgcgacggcagcacagggcagcgcatcggcaccgcgccgtgtggtggtgctgggc
gacagcctgtcagcgggatacggcctggtgcaaggcaccggctgggtcgcactgctgggc
aaccgcctcaaagaacagaagctcgattatagcgtcgccaatgccagcatcagcggcgac
accaccgcaggcgggcgcgctcgcctgccggccgtgcttgcgcgcgagaaacctgccgtg
gtggtgctcgaactgggtgccaacgatgcgctgcgcgggctgtcgctgtctgccagcgaa
gccaacctgaaggcgatgatcgaggcatcgcaagccgccggcgccagggtgctgctggtc
ggcatgcgcatcccgcccaattacggcgcggactacagtgaacgcttcttcgccatgttc
agcaaactggcgcagcagtacaggctgccgctggtgcccttcctcctggaaggcgtggcc
cagcggcccgactggttccaggaggatcgcatccacccggtcgcggcggcgcagccgacg
ctgctcgacaatatctggcccaagcttgaaccgctactcaagggccgggtcggaggatga

DBGET integrated database retrieval system