KEGG   Ralstonia solanacearum PSI07: RPSI07_1839Help
Entry
RPSI07_1839       CDS       T01273                                 

Definition
(GenBank) putative dihydrolipoamide acetyltransferase (Component e2 of pyruvate dehydrogenase complex) protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00010  Glycolysis / Gluconeogenesis
rsl00020  Citrate cycle (TCA cycle)
rsl00620  Pyruvate metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01130  Biosynthesis of antibiotics
rsl01200  Carbon metabolism
Module
rsl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPSI07_1839
   00020 Citrate cycle (TCA cycle)
    RPSI07_1839
   00620 Pyruvate metabolism
    RPSI07_1839
Enzymes [BR:rsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RPSI07_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: CBJ51203
UniProt: D8NTP4
Position
1868884..1870002
Genome map
AA seq 372 aa AA seqDB search
MIVFKLPDLGEGLQEAEIVQWHVKAGDTIEADQPLVSVETAKAIVEIPSPQAGRIARLFG
QPGDIVHLGAPLVAFEGAGGDEADAGTVVGQMQVGQQVVQEAPAVLAAAPGAAAGSIKAT
PAVRALARKLDVDLSMVTPSGPDGVITAADVERVAKVFAELGPPEVLRGVRRAMAQNMAR
AQSEVAAATVIDDADIHAWPPGTDVTIRLIRALVAGCRAEPELNAWFDGHAGRRHVLEKI
DLGIAVDLPDGLFVPVLRDVAHRDAADLRAGLDRMRADIKARKIPPEELRGNTITLSNFG
MIAGKYAAPVVVPPTVAILGAGRIHEQVVAAGGAPAVHRVLPLSLTFDHRVVTGGEAARF
LAAAIADLEAAR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcttcaaactgccggatctgggcgaagggctgcaggaggcggagatcgtgcaa
tggcacgtgaaggccggcgataccatcgaggccgaccagccgctggtctcggtcgagacc
gccaaggccatcgtggagatcccgtcgccgcaggccggccgcatcgcgaggctgttcggc
cagccgggcgacatcgtgcacctgggcgcgccgctggtcgcgttcgaaggggcgggcggc
gacgaggcggatgcgggcaccgtggtcggccagatgcaggtcgggcagcaggttgtgcag
gaggcgccggccgtgctggccgccgcgcccggggcggccgccggcagcatcaaggcgact
ccggccgtgcgggcgctcgcgcgcaagctcgacgtggacctgtcgatggtgacgccctcg
gggccggatggggtcatcacggcggcggatgtcgagcgcgtggccaaggtgtttgccgag
ctggggccgcccgaggtgctgcgcggcgtgcggcgcgccatggcgcagaacatggcgcgc
gcgcagagcgaggtggccgcggccaccgtcatcgacgatgccgacatccacgcctggccg
cccggcaccgacgtgaccatccgcctgatccgcgcgctggtggccggctgccgcgccgag
cccgagctcaacgcctggttcgacggccacgccgggcggcgccatgtgctggagaagatc
gatctcggcatcgccgtcgacctgccggacgggctgttcgtgcccgtgctgcgcgatgtc
gcgcaccgcgatgcggccgacctgcgcgccgggctggaccgcatgcgcgccgacatcaag
gcgcgcaagattccacccgaggagctgcgcggcaacaccatcacgctgtcgaacttcggc
atgatcgcgggcaagtacgcggcgcccgtggtggtgccgccgaccgtggcgatcctgggc
gcgggccgcatccacgaacaggtggtggcggccggcggcgccccggcggtccaccgggtg
ctgccgctgagcctgaccttcgaccaccgggtcgtgaccggcggcgaggcggcgcggttc
ctggccgcggcgatcgcagacctggaggcggcgcgctag

DBGET integrated database retrieval system