KEGG   Ralstonia solanacearum PSI07: RPSI07_1839Help
Entry
RPSI07_1839       CDS       T01273                                 

Definition
dihydrolipoamide acetyltransferase (Component e2 of pyruvate dehydrogenase complex) protein (EC:2.3.1.-)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPSI07_1839
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RPSI07_1839
   00020 Citrate cycle (TCA cycle)
    RPSI07_1839
   00620 Pyruvate metabolism
    RPSI07_1839
Enzymes [BR:rsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RPSI07_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1868884..1870002
Genome map
AA seq 372 aa AA seqDB search
MIVFKLPDLGEGLQEAEIVQWHVKAGDTIEADQPLVSVETAKAIVEIPSPQAGRIARLFG
QPGDIVHLGAPLVAFEGAGGDEADAGTVVGQMQVGQQVVQEAPAVLAAAPGAAAGSIKAT
PAVRALARKLDVDLSMVTPSGPDGVITAADVERVAKVFAELGPPEVLRGVRRAMAQNMAR
AQSEVAAATVIDDADIHAWPPGTDVTIRLIRALVAGCRAEPELNAWFDGHAGRRHVLEKI
DLGIAVDLPDGLFVPVLRDVAHRDAADLRAGLDRMRADIKARKIPPEELRGNTITLSNFG
MIAGKYAAPVVVPPTVAILGAGRIHEQVVAAGGAPAVHRVLPLSLTFDHRVVTGGEAARF
LAAAIADLEAAR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcttcaaactgccggatctgggcgaagggctgcaggaggcggagatcgtgcaa
tggcacgtgaaggccggcgataccatcgaggccgaccagccgctggtctcggtcgagacc
gccaaggccatcgtggagatcccgtcgccgcaggccggccgcatcgcgaggctgttcggc
cagccgggcgacatcgtgcacctgggcgcgccgctggtcgcgttcgaaggggcgggcggc
gacgaggcggatgcgggcaccgtggtcggccagatgcaggtcgggcagcaggttgtgcag
gaggcgccggccgtgctggccgccgcgcccggggcggccgccggcagcatcaaggcgact
ccggccgtgcgggcgctcgcgcgcaagctcgacgtggacctgtcgatggtgacgccctcg
gggccggatggggtcatcacggcggcggatgtcgagcgcgtggccaaggtgtttgccgag
ctggggccgcccgaggtgctgcgcggcgtgcggcgcgccatggcgcagaacatggcgcgc
gcgcagagcgaggtggccgcggccaccgtcatcgacgatgccgacatccacgcctggccg
cccggcaccgacgtgaccatccgcctgatccgcgcgctggtggccggctgccgcgccgag
cccgagctcaacgcctggttcgacggccacgccgggcggcgccatgtgctggagaagatc
gatctcggcatcgccgtcgacctgccggacgggctgttcgtgcccgtgctgcgcgatgtc
gcgcaccgcgatgcggccgacctgcgcgccgggctggaccgcatgcgcgccgacatcaag
gcgcgcaagattccacccgaggagctgcgcggcaacaccatcacgctgtcgaacttcggc
atgatcgcgggcaagtacgcggcgcccgtggtggtgccgccgaccgtggcgatcctgggc
gcgggccgcatccacgaacaggtggtggcggccggcggcgccccggcggtccaccgggtg
ctgccgctgagcctgaccttcgaccaccgggtcgtgaccggcggcgaggcggcgcggttc
ctggccgcggcgatcgcagacctggaggcggcgcgctag

DBGET integrated database retrieval system