KEGG   Ralstonia solanacearum PSI07: RPSI07_1952Help
Entry
RPSI07_1952       CDS       T01273                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:rsl00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2030514..2031695)
Genome map
AA seq 393 aa AA seqDB search
MMRITVLGATGSIGDSTLDVVRRHPDRYRVFALTANTQVDKLAALCRAFRPVMAVVGSAT
AAEALRDRLGADAAGIDIRFGAEALGEAAAHPDCDAVMAAIVGAAGLRPTLAAVRAGKRV
LLANKEALVMSGALFMDAVRQHGATVLPIDSEHNAIFQCLPQQRPSFGRGVARIVLTASG
GPFRTRAVETLAEVTPEQACAHPNWVMGRKISVDSATMMNKGLEVIEAHWLFNVPVERLE
VLIHPQSVIHSMVAYDDGSVLAQLGNPDMRTPIAYGLAYPDRIEAGVPLLDLAATGTLAF
EAPDLHRFPCLALAFDALRAGGTAPAVLNAANEVAVEAFLQHRIRFTEIAAVVSDTLACT
AVGPADSLDTVFAADAEARRRAEHYIAASCLHS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcattaccgttcttggcgccaccggctccatcggcgacagcacgctcgacgtg
gtgcgccgccaccccgaccgctaccgcgtattcgcactgactgccaacacgcaggtcgac
aagcttgccgcgctgtgtcgcgcgttccgtccagtgatggccgtggtcggctcggccacc
gcggccgaggcgctacgggaccggctcggtgcggatgccgccggcatcgacatccgcttc
ggcgccgaagcgctgggagaggctgccgcccaccccgattgcgacgccgtgatggccgca
atcgtcggcgcggcaggcctgcgtccgacgctggccgccgtgcgcgccggcaagcgcgtg
ctgctggccaacaaggaggcgctggtgatgtccggtgcgctcttcatggacgcggtgcgc
cagcacggcgccaccgtgctgccgatcgacagtgagcacaacgccatcttccaatgcctg
ccccagcagcgcccaagcttcgggcgcggcgtggcgcgcatcgtgctgacagcttcgggc
ggcccgttccgcacgcgtgccgtcgagacgctggccgaggtcacgcccgagcaggcctgc
gcccacccgaactgggtgatgggccgcaagatttccgtcgactccgccaccatgatgaac
aaggggctggaggtgatcgaggcgcactggctgttcaacgtgccggtcgagcggctcgag
gtgctgatccacccgcagagcgtgatccattcgatggtcgcttacgacgatggctcggtc
ctggcacagctcggcaacccggacatgcggacgccgatcgcctacgggcttgcgtacccc
gatcgcattgaggccggtgttccgctgctggatctggccgcgaccggcacgcttgcgttc
gaagcgcccgatctgcaccgcttcccgtgcctggccctggccttcgatgccctgcgcgcc
ggtggcacggcacctgctgtgctgaacgcggccaacgaggtggcggtcgaagcatttttg
cagcaccgtatccgcttcaccgagattgccgcggtggtgagcgacacgctggcgtgcacg
gctgtcgggccggcggattcgctcgacacggtgttcgccgccgatgcggaggcgcggcgc
cgcgccgagcattatattgctgcgtcatgtctgcattcttga

DBGET integrated database retrieval system