KEGG   Ralstonia solanacearum PSI07: RPSI07_1973Help
Entry
RPSI07_1973       CDS       T01273                                 

Gene name
dapE
Definition
(GenBank) N-succinyl-diaminopimelate deacylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00300  Lysine biosynthesis
rsl01100  Metabolic pathways
rsl01120  Microbial metabolism in diverse environments
rsl01230  Biosynthesis of amino acids
Module
rsl_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    RPSI07_1973 (dapE)
Enzymes [BR:rsl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     RPSI07_1973 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: CBJ51337
UniProt: D8NU19
Position
2057092..2058243
Genome map
AA seq 383 aa AA seqDB search
MSPTLALTEDLIRRRSVTPEDKGCQDVLIERLSAAGFQCEAVVSGPDHFRVTNLWAVKRG
RAGTGGKLLVFAGHTDVVPTGPVEQWHSDPFEPTHRDGKLYGRGAADMKTSIAGFVVASE
EFVAKHPDHAGSIGFLITSDEEGPAHDGTVKVCDLLRARGERLDYCVVGEPTSVSTLGDM
VKNGRRGSLSGKLTVNGVQGHIAYPHLAKNPIHLAVPALTALAAEKWDDGNAYFPPTTWQ
MSNIHGGTGATNVIPGHVTIDFNFRFSTASTPEGLKSRVHAILDAHGLDYTLAWTLGGEP
FLTERGELSEALSTAIQAECGVATELSTTGGTSDGRFIAKLCPQVIEFGPPNASIHKIDE
HVDVAFIEPLKNVYRRVLETLVA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccacgcttgccctcactgaagacctgatccgccgccgctccgtcacgcccgaa
gacaagggctgccaggacgtgctgatcgaacgcctgtccgccgccggcttccaatgcgaa
gcggtggtcagcgggccggaccacttccgcgtgaccaacctgtgggcggtcaagcgcggc
cgcgcgggcaccggcggcaagctgctggtcttcgccggccacaccgacgtggtgccgacc
ggccccgtggagcagtggcactccgacccgttcgagccgacccaccgcgacggcaagctc
tatggccgtggcgccgccgacatgaagacctcgatcgccgggttcgtggtcgcctcggaa
gaattcgtcgccaagcatccggaccacgccggctcgatcggcttcctgatcaccagcgac
gaggaaggcccggcccacgacggcaccgtcaaggtctgcgacctgctgcgcgcgcgcggc
gagcggctggactactgcgtggtgggcgagccgacctcggtgtccacgctgggcgacatg
gtcaagaacgggcggcgcggctcgctgtcgggcaagctcaccgtcaacggcgtgcagggc
cacatcgcctatccgcacctggccaagaacccgatccacctggccgtgccggcgctgacc
gccctggcggccgagaaatgggacgacggcaacgcctacttcccgccgaccacctggcag
atgtcgaacatccacggcggcaccggcgcgaccaacgtgattccgggccatgtcaccatc
gacttcaacttccgcttctcgacggcgagcacgcccgagggcctgaagtcgcgcgtgcat
gccatcctcgacgcgcacggcctggactacacgctggcctggacgctgggcggcgagccc
ttcctgaccgagcgcggcgagctgtcggaggcactgtcgacggccatccaggccgagtgc
ggcgtcgccaccgagctgtcgaccaccggcggcacgtcggatggccgcttcatcgccaag
ctgtgcccgcaggtgatcgagttcgggccgcccaacgccagcatccacaagatcgacgag
cacgtcgacgtggccttcatcgagccgctcaagaacgtgtaccggcgcgtgctcgaaacg
ctggtcgcctga

DBGET integrated database retrieval system