KEGG   Ralstonia solanacearum PSI07: RPSI07_2003Help
Entry
RPSI07_2003       CDS       T01273                                 

Gene name
aceB
Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPSI07_2003 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPSI07_2003 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    RPSI07_2003 (aceB)
Enzymes [BR:rsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RPSI07_2003 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2090200..2091789)
Genome map
AA seq 529 aa AA seqDB search
MTTMELTLPQGMEIKAEILPAYEDILTPEALALVARLHRAFEPRRQQLLAARAERAKRLD
AGERPDFLPETRHIREGDWTIAGIPPALECRRVEITGPVDAKMVINAFNSGADSYMTDFE
DSNAPSWHNQIQGQVNLKAAIRRTLTLESGGKSYRLNDKIATLQVRPRGWHLDEKHVTVD
GQRVSGGIFDFALFFFHNAREQLARGAGPFFYLPKMESHLEARLWNDVFVAAQTELGLPL
GTIKATVLIETILAAFEMDEILYELREHSAGLNAGRWDYIFSCIKKFKVDKSFCLADRAK
VTMTSPFMRAYALLLLQTCHKRNAPAMGGMSALIPIKNDPEKNAIAMQGIISDKKRDATD
GYDGGWVAHPGLVEAAMKEFVDVLGDAPNQIGKQRPDVNMTAADLLNFQPEQPITEAGLR
MNINVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLEDGTKVTAEL
VRKLIPEELAKVKEAGAVGHFDRAAQIFEQMSTSESFSEFLTLPLYEEL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccatggagctgacgctgccccaaggcatggagatcaaggccgagatcctgccg
gcctacgaagacattctgacccccgaagcgctggccctggtcgccaggctgcaccgggcc
ttcgagccgcgccgccagcaactgctggccgcccgcgccgagcgcgccaagcgcctggat
gccggcgagcgcccggacttcctgccggaaacccggcacattcgcgagggcgactggacc
atcgccgggatcccgcccgcgctggaatgccgccgcgtggagatcaccggcccggtcgac
gccaagatggtcatcaacgcgttcaactcgggcgcggacagctacatgaccgacttcgag
gactccaacgccccgagctggcacaaccagatccagggccaggtcaacctgaaggccgcc
atccgccgcacgctcacgctggagtcgggcggcaagtcctaccggctcaacgacaagatc
gccacgctgcaggtgcgcccgcgtggctggcacctcgacgagaagcacgtgacggtggac
ggccagcgcgtctcgggcggcatcttcgacttcgcgctgttcttcttccacaacgcgcgc
gagcagctggcgcgtggcgccggcccgttcttctacctgccgaagatggagagccacctg
gaagcgcgcctgtggaacgacgtcttcgtcgccgcgcagaccgagctcggcctgccgctg
ggcaccatcaaggccaccgtgctgatcgagaccatcctcgccgcgttcgagatggacgag
atcctgtatgagctgcgcgagcacagcgcgggcctgaacgccggccgctgggattacatc
ttttcgtgcatcaagaagttcaaggtggacaagagcttctgcctggccgaccgcgccaag
gttacgatgacgtcgccgttcatgcgcgcctacgcgctgctgctgctccagacctgccac
aagcgcaacgcgccggccatggggggcatgagcgcactgatcccgatcaagaacgatccg
gagaagaacgccatcgccatgcagggcatcatcagcgacaagaagcgcgacgcgaccgac
ggctacgacggcggctgggtggcgcacccgggcctggtcgaggcggccatgaaggaattc
gtggacgtgctgggcgacgcccccaaccagatcggcaagcagcgccccgacgtgaacatg
acggccgccgatctgctgaacttccagcccgagcagcccatcaccgaggccggcctgcgc
atgaacatcaacgtcggcatccattacctgggcgcctggctggccggcaacggctgcgtg
ccgatccacaacctgatggaagacgcggccacggccgagatctcgcgctcgcaggtgtgg
cagtggatccgctcgcccaagggcacgctggaagacggcaccaaggtcacggccgagctg
gtgcgcaagctgatccccgaagaattggccaaggtgaaggaggccggcgcggtgggccat
tttgatcgcgccgcgcagatcttcgaacagatgtccacgtcggaatccttctcggaattc
ctgacgctgccgctgtacgaagaactctga

DBGET integrated database retrieval system