KEGG   Ralstonia solanacearum PSI07: RPSI07_2003Help
Entry
RPSI07_2003       CDS       T01273                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
rsl00620  Pyruvate metabolism
rsl00630  Glyoxylate and dicarboxylate metabolism
rsl01100  Metabolic pathways
rsl01110  Biosynthesis of secondary metabolites
rsl01120  Microbial metabolism in diverse environments
rsl01200  Carbon metabolism
Module
rsl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RPSI07_2003 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    RPSI07_2003 (aceB)
Enzymes [BR:rsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     RPSI07_2003 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase FlpD
Motif
Other DBs
NCBI-ProteinID: CBJ51367
UniProt: D8NU47
Position
complement(2090200..2091789)
Genome map
AA seq 529 aa AA seqDB search
MTTMELTLPQGMEIKAEILPAYEDILTPEALALVARLHRAFEPRRQQLLAARAERAKRLD
AGERPDFLPETRHIREGDWTIAGIPPALECRRVEITGPVDAKMVINAFNSGADSYMTDFE
DSNAPSWHNQIQGQVNLKAAIRRTLTLESGGKSYRLNDKIATLQVRPRGWHLDEKHVTVD
GQRVSGGIFDFALFFFHNAREQLARGAGPFFYLPKMESHLEARLWNDVFVAAQTELGLPL
GTIKATVLIETILAAFEMDEILYELREHSAGLNAGRWDYIFSCIKKFKVDKSFCLADRAK
VTMTSPFMRAYALLLLQTCHKRNAPAMGGMSALIPIKNDPEKNAIAMQGIISDKKRDATD
GYDGGWVAHPGLVEAAMKEFVDVLGDAPNQIGKQRPDVNMTAADLLNFQPEQPITEAGLR
MNINVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLEDGTKVTAEL
VRKLIPEELAKVKEAGAVGHFDRAAQIFEQMSTSESFSEFLTLPLYEEL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccatggagctgacgctgccccaaggcatggagatcaaggccgagatcctgccg
gcctacgaagacattctgacccccgaagcgctggccctggtcgccaggctgcaccgggcc
ttcgagccgcgccgccagcaactgctggccgcccgcgccgagcgcgccaagcgcctggat
gccggcgagcgcccggacttcctgccggaaacccggcacattcgcgagggcgactggacc
atcgccgggatcccgcccgcgctggaatgccgccgcgtggagatcaccggcccggtcgac
gccaagatggtcatcaacgcgttcaactcgggcgcggacagctacatgaccgacttcgag
gactccaacgccccgagctggcacaaccagatccagggccaggtcaacctgaaggccgcc
atccgccgcacgctcacgctggagtcgggcggcaagtcctaccggctcaacgacaagatc
gccacgctgcaggtgcgcccgcgtggctggcacctcgacgagaagcacgtgacggtggac
ggccagcgcgtctcgggcggcatcttcgacttcgcgctgttcttcttccacaacgcgcgc
gagcagctggcgcgtggcgccggcccgttcttctacctgccgaagatggagagccacctg
gaagcgcgcctgtggaacgacgtcttcgtcgccgcgcagaccgagctcggcctgccgctg
ggcaccatcaaggccaccgtgctgatcgagaccatcctcgccgcgttcgagatggacgag
atcctgtatgagctgcgcgagcacagcgcgggcctgaacgccggccgctgggattacatc
ttttcgtgcatcaagaagttcaaggtggacaagagcttctgcctggccgaccgcgccaag
gttacgatgacgtcgccgttcatgcgcgcctacgcgctgctgctgctccagacctgccac
aagcgcaacgcgccggccatggggggcatgagcgcactgatcccgatcaagaacgatccg
gagaagaacgccatcgccatgcagggcatcatcagcgacaagaagcgcgacgcgaccgac
ggctacgacggcggctgggtggcgcacccgggcctggtcgaggcggccatgaaggaattc
gtggacgtgctgggcgacgcccccaaccagatcggcaagcagcgccccgacgtgaacatg
acggccgccgatctgctgaacttccagcccgagcagcccatcaccgaggccggcctgcgc
atgaacatcaacgtcggcatccattacctgggcgcctggctggccggcaacggctgcgtg
ccgatccacaacctgatggaagacgcggccacggccgagatctcgcgctcgcaggtgtgg
cagtggatccgctcgcccaagggcacgctggaagacggcaccaaggtcacggccgagctg
gtgcgcaagctgatccccgaagaattggccaaggtgaaggaggccggcgcggtgggccat
tttgatcgcgccgcgcagatcttcgaacagatgtccacgtcggaatccttctcggaattc
ctgacgctgccgctgtacgaagaactctga

DBGET integrated database retrieval system