KEGG   Ralstonia solanacearum PSI07: RPSI07_2039Help
Entry
RPSI07_2039       CDS       T01273                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rsl  Ralstonia solanacearum PSI07
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rsl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RPSI07_2039 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RPSI07_2039 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RPSI07_2039 (thrC)
Enzymes [BR:rsl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RPSI07_2039 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2129152..2130672)
Genome map
AA seq 506 aa AA seqDB search
MSMQYRSTRGHAEPQSFSRILLGGLAPDGGLYLPEQYPQVSIDELTRWRDLPYADLAFEI
LRKFATDLPEDDLRALARRTYTPEVYSNARNGDDTADITPLHRLGEEGGTSLSLLCLSNG
PTLAFKDMAMQLLGNLFEYALDREHAELNILGATSGDTGSAAEYAMRGKRGVRVFMLSPH
RKMSAFQTAQMFSLQDENIFNIAIEGVFDDAQDIVKAVSNDLEYKARQKIGTVNSINWAR
VVAQVVYYFKGYLLATTPADHPSGQVGASPSNPPAKRGEVGALPKVSFCVPSGNFGNVCA
GHIARMMGLPIDKLVVATNENDVLDEFFRTGTYRVRSAAQTYHTSSPSMDISKASNFERF
VFDLLDRDPARLVQLFRDVEEKGGFSLTGKPEFDRIAAFGFVSGRSTHEDRVNTIRDVFA
RYGTMIDTHTADGVKVAREHLSPGVPMVVLETALPAKFGDTIREALDREPERPVGYADIE
SLPQRFEVMPADADRVKAYIAQHTGL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgcaataccgttccacgcgcggccacgccgagccgcagagcttttcccgcatc
ctgctgggcggcctggcgccggacggcggcctgtacctgcccgagcagtacccgcaagtc
agtatcgacgagctgacccgctggcgcgacctgccgtatgcggatctcgctttcgagatc
ctgcgcaagttcgccaccgacctccccgaggatgacctgcgcgcgctggcccgccgcacc
tacacgcccgaggtctacagcaacgcgcgcaacggcgacgacaccgccgacatcacgccg
ctgcaccgcctgggcgaggaaggcggcacgtcgctgtcgctgctgtgcctgtcgaacggc
ccgacgctggccttcaaggacatggcgatgcaactgctgggcaacctgttcgaatatgcg
ctcgaccgcgagcatgccgagctgaacatcctgggcgccacctccggcgacaccggcagc
gcggccgaatacgccatgcgcggcaagcgcggcgtgcgcgtcttcatgctgagcccgcac
cgcaagatgagcgcgttccagaccgcgcagatgttcagcctgcaggacgagaacatcttc
aacatcgccatcgaaggcgtgttcgatgacgcccaggacatcgtcaaggccgtgtcgaat
gatctggagtacaaggcccgccagaagatcggcacggtcaactcgatcaactgggcgcgc
gtggtggctcaggtcgtgtattacttcaagggttatctgttggcgacgacgccagcagat
cacccgtcggggcaggtgggggcatccccctctaatcccccagccaagcggggggaggtg
ggcgccttgccgaaggtgtcgttctgcgtgccgtcgggcaacttcggcaacgtctgcgcg
ggccacatcgcgcgcatgatgggcctgccgatcgacaagctggtggtggccaccaacgag
aacgacgtgctcgacgagttcttccgcaccggcacctaccgtgtgcgctcggccgcgcag
acgtaccacacgtccagcccgagcatggacatttccaaggcgtcgaacttcgagcgtttc
gtgttcgatctgctcgatcgcgatccggcgcgcctggtgcagctgttccgcgacgtggag
gagaagggcggcttctcgctgacgggcaagccggagttcgaccgcatcgccgcattcggc
ttcgtctcgggccgcagcacgcacgaagaccgcgtcaacaccatccgcgacgtgttcgcc
cgctacggcacgatgatcgacacgcacaccgccgacggcgtcaaggtcgcgcgcgaacac
ctgtcgcccggcgtgccgatggtggtgctggagaccgcgctgccggctaagttcggcgac
accatccgcgaggcgctggaccgcgagccggagcgcccggtcggttacgccgacatcgaa
tcgctgccgcagcgcttcgaggtgatgccggccgatgcggaccgcgtgaaggcgtacatc
gcgcagcacaccggtctgtaa

DBGET integrated database retrieval system